KEGG   Enterobacter soli: Entas_1539Help
Entry
Entas_1539        CDS       T01604                                 

Definition
(GenBank) histidine acid phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
eas  Enterobacter soli
Pathway
eas00010  Glycolysis / Gluconeogenesis
eas01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_1539
Enzymes [BR:eas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Entas_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AEN64281
Position
1682050..1683291
Genome map
AA seq 413 aa AA seqDB search
MRKALLAVAVAGSISMTFGAQAQDAPEGYQLEQVLIMSRHNLRAPLANNGSVLEQSTPNK
WPEWDVPGGQLTTKGGVLEVYMGHYMREWLAGQGLVTTGECPPANTVYAYANSLQRTVAT
AQFFITGAFPGCDVPVHHQPEMGTMDPTFNPVITNNSPEFRDKALSAMASERQKMQLDES
YKLLEQMTNYADSPSCKEKKVCSLTDAKDTFSADYEKEPGVSGPLKVGNSLVDAFTLQYY
EGFPADQVAWGEIKTDQQWRVLSKLKNGYQDSLFTSGEVARNVAKPLVKYIDNALVTEQG
KAAKITLLVGHDSNIASLLTALDFKPYQLHDQYERTPIGGKIVFQRWHDKNANRELMKIE
YVYQSTTQLRNAEVLSLKSPAQRVTLELSGCPVDDNGFCPVEKFNTVLNNAAK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcactactcgctgttgcagtggcaggttccatatccatgacgttcggcgct
caggcgcaggacgcaccagaaggataccagttagagcaagttttaatcatgagccgccat
aatctgcgcgcgccgctggccaataacggcagcgtgctggaacaatccacgccgaataag
tggccggaatgggatgtgcccggcgggcagctcaccaccaaaggtggcgttctcgaagtg
tatatggggcactatatgcgcgaatggctggccgggcaggggctggtgaccaccggggaa
tgcccgcctgcgaataccgtttatgcctacgccaatagcctgcaacgcaccgtggcgacc
gcgcagttctttatcaccggcgctttcccggggtgtgacgtgccggtgcatcaccagccg
gaaatggggacgatggaccccacctttaaccctgtcatcaccaacaactcaccggaattc
cgcgataaagcgctgagcgcaatggcgtcagagcggcagaaaatgcagcttgatgaaagc
tacaagctgctggaacagatgacgaattacgccgactcgccatcctgcaaagagaaaaag
gtttgttcgctgacggacgccaaagacactttcagtgctgattacgaaaaagagccgggc
gtatccgggccgctgaaggtggggaactccctggtggatgcgttcaccttgcagtactac
gaaggcttcccggccgatcaggtggcgtggggcgaaatcaaaaccgatcagcagtggcgc
gtgttgtcgaagctgaaaaatggctatcaggattcgttattcacctcgggtgaagtggcg
cgcaatgtggcgaaaccgctggtgaaatacatcgacaacgccctggtgactgagcaggga
aaagccgcaaaaatcacgctgctggtgggacacgattccaacatcgcctcgctgctgacg
gcgctcgatttcaaaccttatcagctgcatgaccagtacgaacgcaccccgattggcggc
aaaattgtcttccagcgctggcatgacaagaacgccaaccgggagctgatgaaaatcgaa
tatgtttatcaaagcactacgcagctgcgtaacgctgaggttctgtcgctgaaatcaccc
gcgcagcgtgtcacgctggagctttcagggtgtccggtggatgataacgggttctgcccg
gtagagaagtttaatacggtgttgaacaacgcggcgaaataa

DBGET integrated database retrieval system