KEGG   Enterobacter soli: Entas_1901
Entry
Entas_1901        CDS       T01604                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_1901
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1901
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1901
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEN64640
Position
complement(2046543..2047025)
AA seq 160 aa
MAIPGNMWLYDDGGALIKGGCDVQHREYSIEFKGFHHNLSTPTDNLTGKPTGKRIHSPMM
IVKEFDYASPYLYKAVATGQALQKAELKFYKINDAGQEAEYFNILLEGVRIVSVSPAMAA
PGDNNNNHLETVELRYEKITWKHNDGNIIFSDAWNERATA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattccaggcaatatgtggctgtacgatgatggcggtgcgcttatcaaaggcggt
tgtgatgtgcagcatagggaatacagcattgagttcaaagggtttcaccataatctttcg
acgccaaccgataacctgacaggtaaacctactggtaaacgtatccactctccgatgatg
attgtaaaggagttcgattacgcatctccctatctctataaagccgtcgccactggtcag
gctctacaaaaagccgaactcaagttctacaagattaatgacgcgggtcaggaagctgaa
tacttcaatattcttctggaaggcgtgcggatagtttcggtttcacccgccatggccgct
cccggcgacaacaataataatcacctcgaaacggttgaattgcgttacgagaaaattact
tggaagcataacgacggcaatattattttctctgacgcatggaatgaacgggcgacggct
taa

DBGET integrated database retrieval system