KEGG   Enterobacter soli: Entas_1919
Entry
Entas_1919        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1919
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1919
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEN64658
Position
2064431..2064928
AA seq 165 aa
MADSFQNEVPKARINLKLDLHTGGASKKTELPLKLLVAGDFSNGRESAPLSERKKVTLNK
NNFDAVLSDYSPDVNLTVKNTLADDGSEDNISLTFQSMKDFTPEQVSRQIPQLKAMLSMR
NLLRDLKANLLDNQAFRKELEKILLDPALSAELRSELSALAPKQP
NT seq 498 nt   +upstreamnt  +downstreamnt
atggctgacagtttccagaatgaagtaccgaaggcacgtattaatctaaaacttgacctg
catacagggggagccagcaagaaaacggaacttcccctgaaattactggtggcaggtgac
ttcagtaacggtcgcgagtccgcaccattatcagagcgtaaaaaagttactctgaataaa
aacaactttgacgcagtgctttccgattattccccagacgtaaacctgaccgttaaaaac
acacttgctgatgacggcagcgaagacaatatcagtctgactttccagagcatgaaggat
ttcactcctgaacaggtctcccggcaaatacctcagctgaaggccatgctttccatgcgc
aatctgcttcgtgatttaaaagcgaacctgcttgataaccaggctttccgtaaggaactg
gaaaagattctgctcgaccctgcgttaagcgcagaacttcgctcagagctgtctgccctg
gccccgaaacagccataa

DBGET integrated database retrieval system