KEGG   Enterobacter soli: Entas_1920
Entry
Entas_1920        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1920
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1920
SSDB
Motif
Pfam: VipB VipB_2 APG6 PaaA_PaaC
Other DBs
NCBI-ProteinID: AEN64659
Position
2064968..2066509
AA seq 513 aa
MSVKNENAAGGESVVLERPAAGGVYASLFEKINLNPVSELSALDIWQDAQAMSDATADER
LTAGMQVFLECLTKSGSKIEKLDKTLIDHHIAELDYQISRQLDAVMHSEEFQAVESLWRG
VKSLVDKTDFRQNVKIELLDMSKEDLRQDFEDSPEIIQSGLYKHTYIDEYDTPGGEPIAA
LISAYEFDASAQDVALLRNISKVSAAAHMPFIGSAGPKFFLKDSMEDVAAIKDIGNYFDR
AEYIKWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHDKYLWTNA
SFAFASNMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPSEVMIPETREF
EFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNP
GFFRVKLYAIPHFQVEGMDVNLSLVSQMPKAKS
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgtctgtaaaaaatgaaaatgctgcgggtggtgagagtgtggtgctggaacgtcctgca
gcaggtggcgtttatgcgtccctgtttgaaaaaatcaacctgaacccggtgtccgagctg
agtgcgctggatatctggcaggatgcacaggcgatgtcggatgcgactgcagatgaacgt
ttaacggcggggatgcaggtgttccttgagtgcctgacaaaatcgggctccaaaattgaa
aaactcgataaaacgctgattgatcaccatatcgcggagttggactatcagattagccgt
cagctggatgcggtcatgcacagtgaagaattccaggcggtagaaagtctgtggcgtggc
gtgaaatcgctggtcgacaaaaccgatttccgccagaacgtgaagattgagctgctggac
atgtccaaagaagacctgcgtcaggacttcgaagacagcccggaaatcatccagagtgga
ctgtataaacatacctatatcgatgagtatgacaccccggggggagagccgatcgccgcg
ctgatttcggcctatgagtttgatgcgtctgcgcaggatgtcgcgttgttgcgcaatatc
tctaaagtgtctgccgcagcgcacatgccgtttatcggctctgccggcccgaaattcttc
ctgaaggactcaatggaggatgtggcggccatcaaggatatcggtaactattttgaccgt
gcggaatacatcaagtggaaatctttccgtgagacggacgatgcccgttatatcggtctg
gtgatgccgcgagtgttgggtcgtctgccgtatggcccggacaccgtaccggtgcgtagc
ttcaattatgtcgaagaagtgaaaggtccggatcatgacaaatacctgtggaccaacgcc
tcatttgcctttgcatccaacatggtgaagagctttatcaataacggctggtgtgtacaa
atccgtggcccgcaggccggtggtgccgtccaggatttgcctatccatctgtacgatctg
ggtaccggtaatcaggtaaaaatcccgagtgaagtgatgatcccggaaacccgcgaattt
gaatttgccaacctgggcttcattcccctgtcgtactacaaaaaccgcgactacgcctgc
tttttctcggcaaactcgacccagaaaccagccctgtatgataccgccgatgcaacggcc
aacagccgtatcaatgcgcgtcttccctacatcttcctgctgtcacgtattgcacactac
ctgaagctgattcagcgtgaaaacatcggtaccactaaagatcgtcgcctgctggagctg
gagctgaacacctgggttcgcagtctggtgacggaaatgaccgacccgggcgatgagttg
caggcctctcacccactgcgcgacgccaaagtggtggtggaagacatcgaagacaacccg
ggattcttccgtgtgaaactgtatgcgatcccgcacttccaggtggaagggatggacgtc
aatctgtcactggtctctcagatgccgaaggcgaaatcataa

DBGET integrated database retrieval system