KEGG   Enterobacter soli: Entas_1921
Entry
Entas_1921        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1921
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1921
SSDB
Motif
Pfam: T6SS_VasE CortBP2
Other DBs
NCBI-ProteinID: AEN64660
Position
2066527..2067867
AA seq 446 aa
MKTEQPLWGRGVMVSPQHFQQQAAYAAWSAECIARLGLSHPWGMIEAIFEPDALKMGRLQ
ARHLHIRFPDGTLIDTDNADDLPPVLALEGESQEVVVVLALPLLRANGGNCLKPDEVAER
PVRFRQRWRDVRNTFGEDTRQIAVMRPELTLRFAHQNNSDYLTCPVARLQQDSQGTWLLD
ETFLPPLLTIQGSRWLVTQLEQLMTQLRARLSRLMAMRRESNERMADFAVADVSLFWLLN
ALNSAEPVLGQFLRHPQSPPERLYPELARLAGSLLTFSLEHQVSAIPVWQHEQLNNVFPP
LFELLGDLLEASLPSRVVAIELEHDARLHFWQARLHDPRLRKGADYYLSIRSSIPVAQLQ
EQVPRQCKVGSPDHVRSIVNSSRVGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEML
QSGTCMFYVPGMLGEPELELFAVLRT
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaaacggaacaaccgttatggggtaggggcgtgatggtctctccccagcacttccag
caacaggccgcgtatgcggcctggtctgcggaatgcattgcccgactgggtctctcccat
ccctggggaatgattgaggccattttcgaaccggatgcactgaaaatgggccgcctgcag
gcccgtcatctgcacatccgttttcccgatggcacgcttatcgacacggataatgctgac
gacctgccgccggtgctggcgcttgagggcgaatcgcaggaagtggtggtggtcctggcc
cttccgttgcttcgggcgaatggcggcaactgccttaaacccgatgaggtggctgaacgc
ccggtacgtttccgtcagcgctggcgggatgtccgcaataccttcggagaagatacccgt
cagattgctgtaatgcgcccggagttgacgttgcggtttgcacatcagaataacagcgat
tacctgacctgcccggtcgcccgcctgcagcaggattcgcaggggacgtggttactggat
gaaacatttctccccccgctccttaccatccagggcagtcgctggctggtgacccagttg
gaacagctgatgacacagctgcgtgcccgtctgagccgcctgatggccatgcgtcgtgaa
agtaacgaacgcatggccgattttgccgtggctgatgtgtcactgttctggttgctcaat
gccctaaacagcgcagaacccgtgctcggacagttcctgcgccacccgcaaagtccgcct
gagcgtctgtatccggagttggcacgccttgcgggcagcctgctgaccttctcactggaa
caccaggtgagtgctattccggtctggcaacatgagcaactgaataatgtcttcccgccg
ttgtttgaattactgggcgacctgctggaagccagcctgccgtcgcgggtggtcgctatt
gagcttgagcatgatgcgcggctgcacttctggcaggctcgtctgcatgacccacgtctg
cgtaaaggggcagattactacctttccatacgttcatcgattccggtggcgcaacttcag
gagcaggtcccgcgccagtgcaaggtcggcagccccgatcatgtcaggagtatcgtcaat
tcatcacgggtgggggtgcctctgacgccgctgcgccatgtgccggccgccattccactg
cgtctggaaaaccagtatttcagcctcgatgtctctcatcctctggcaaccgaaatgctt
cagagcggcacctgtatgttttacgtgccggggatgctcggcgagccggaacttgaactc
tttgcggtactgagaacatga

DBGET integrated database retrieval system