KEGG   Enterobacter soli: Entas_1922
Entry
Entas_1922        CDS       T01604                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_1922
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1922
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1922
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AEN64661
Position
2067864..2068553
AA seq 229 aa
MSERKRGVAASIDIDALLQDTWLQVISLRHGPTFQDGEGRTLWERCIADVECVQRELKAS
ELDEASCQHILTAQCALLDEAVKGRGVEDDACVQWYDIPLQGHFLGTMDAGDTLCDRMRD
VLREPAPDHAVVTCFQRVMMLGFLGSFRSLNDPERQKLANALSEHVTPFSYPQTHPVLAE
SRAGRGMGGWLASWPVRIGLSVMVLVALWWGLDHWLDQTLLTLLPGAVK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagtgagcgcaaacgcggcgtggccgcgtcgattgatattgatgccctgttgcaggac
acctggctgcaggtgatcagcctgcgtcacggtccgacgtttcaggatggagaagggcgc
acgctgtgggagcgctgcattgctgatgttgagtgcgtgcagcgtgagctgaaagcgagc
gaactcgatgaagccagttgccagcatattctcactgcccagtgtgcactgcttgatgaa
gcggtcaaaggtcgtggtgtggaggatgacgcttgtgtgcaatggtatgacattccccta
cagggacatttcctcggcaccatggatgccggtgatacgctgtgcgatcgaatgcgtgat
gtgctgcgtgaaccggcgcctgaccacgctgttgtcacctgctttcagcgggtcatgatg
ctggggttcctcggcagttttcgctcgctgaacgatccggagcgccaaaaactcgccaac
gcgctcagtgaacatgtcacgccgttcagctatccgcagactcacccggtactggcagaa
agccgtgccgggcgtggaatgggcggctggctggcgtcatggcccgtgcgtattggcctg
agcgtgatggtgctcgtcgcactctggtggggactggatcactggctggatcagacgctg
ctgaccctgctaccgggagccgtgaaatga

DBGET integrated database retrieval system