KEGG   Enterobacter soli: Entas_1924
Entry
Entas_1924        CDS       T01604                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_1924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1924
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1924
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEN64663
Position
2070261..2070752
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQQHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPEMYD
IKDPSKEKHNHLERIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggcgcggacattaaaggttct
gtggacgttcaggatcgtgaaggcagcatcgaagtggtggcacagcagcataacctgtac
atcccgactgacaacaacaccggcaaactgaccggtacccgtatccacaccccgttcctg
ttcaccaaggaaatcgactcgtccagtccgtacctgtacaaggcggtgaccaccggtcag
accctcaagtctgcggaattcaagtggtacaaaatcaacgacgcgggccaggaagtggag
tacttcaacaccaaactggaaaacgtgaaagtggtgaaagtgaatcctgaaatgtatgac
atcaaggatccttctaaagagaagcacaaccaccttgagcgcattgaactgcgttacgaa
aaaatcacctggacctacaaagacggcaacatcattcattccgattcctggaacgaacgc
gccaccgcctaa

DBGET integrated database retrieval system