KEGG   Enterobacter soli: Entas_1926
Entry
Entas_1926        CDS       T01604                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_1926
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1926
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1926
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: AEN64665
Position
2073577..2075955
AA seq 792 aa
MSSHLPIRFSHNHHQLSVKECEAELDVLAFEGDEALSTPFSYRIEFTSSDHAISKEMMLM
KAASLTLQAPVDQGYGIKIQQAVRTLQGVVSGFERLNTSKDETHYALTLQPRLALLDRSH
QNAIYQDISVPQIVEKILRERHSMRGQDFLFSLAKEYPRREQVMQYGEDDLHFITRLLGE
VGIWFRFTTDTRLNIDVVEFYDSQQGYEKGLTLPSVPPSGQHSKGVDSVWGMECHHNVVQ
KQVSTRDYNYRQATDDMNTLVDATRGDITTYGDAYHYADNYLIQGSAYDRNPAPESGAFY
ARIHHERYLNGQTKAQAITSCPTLAPGMQLKVTGGYEVAEVFSQGVVITRMHTHARRDED
FGVHFEGIPDSTDFSFRPEPGLRPVMAGTLPARVTSTTENDTYGHIDKDGRYRVNMLFDR
DNWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYISGVLHDSAHGD
HVTIQNYKRNVLRTPANNKIRLDDERGKEHIKISTEYGGKSQLNLGHLVDSEKQKRGEGF
ELRTDSWGAIRAQKGIFISADGQAKAQGDVLAMEQAISLLKGAVNQVAEWEELARTHQNF
APDTQPLQALVSGASVLKEPTLLMSAPKGIAAVTPETAVVHTGKGLYLQSLGEVNLNTAQ
RYSVNAKQAISVMAHQEGIRLVSAKGPLAVESHADTLSLTSMKDVTVQSTQGHLQLTAKN
GITLACGGAYIKLTPQGEINVHGPGLLSLKGQHKLQGPASEDYPLPELPSSVCKECLKKA
QRLAQGFVPRGA
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgagcagtcatctcccgatcagattcagtcacaaccatcaccagctgtcggtgaaggaa
tgtgaagcagaactcgatgtgctggcgtttgaaggcgatgaagccctgagcacgccgttc
agctaccgtattgaattcacaagctctgaccatgccatcagcaaagaaatgatgctgatg
aaggcggcctccctgacgttgcaggctccggttgatcagggttacggcatcaaaattcag
caggctgtgcgtactcttcagggggtggtgagtggctttgaacgtctcaacacctcaaag
gatgaaactcattacgcgctgacgttgcagccccgcctggcgctgcttgaccgttcgcac
cagaacgccatttatcaggacatatcggtcccacaaatcgtggaaaaaatcctgcgcgag
cgccacagcatgcgcggccaggattttctgttctctcttgcaaaagagtacccgcgccga
gagcaggtgatgcagtacggcgaggacgacctgcactttattacccgcctgctgggtgaa
gtcggtatctggttccgctttaccaccgacacacgtctgaacatcgacgtggtggagttt
tacgacagccagcagggttacgagaaaggtctgaccctgccatctgtgccgccgtccggc
cagcattcaaagggcgtggattcagtctggggcatggagtgccaccacaacgtggtgcag
aagcaggttagcacccgtgattacaactatcggcaggcgacggatgacatgaacaccctg
gtggacgcaacccgtggggatatcaccacctacggcgatgcttatcactatgcggataac
tatctgatacaaggaagtgcgtatgaccgcaacccagccccggagtccggtgcgttttac
gctcgcatacaccatgagcgctacctgaatggccagacgaaggcgcaggccatcaccagc
tgtccgacgctggccccggggatgcagttgaaagtcaccggcggctatgaagtggcagag
gtgttcagtcagggcgttgttattacccgtatgcacactcacgcaaggcgtgatgaagat
tttggtgtgcattttgaggggataccggacagcactgattttagttttcgtccggagcca
ggcttacgcccggtgatggcaggcacgctgcccgcgcgcgttaccagcactactgaaaac
gatacctacgggcatatcgataaagacggccgctaccgcgtcaacatgctgttcgaccgt
gataactgggagaccgggttcgaaagcctgtgggtgcgtcagtcccgaccgtacgccggt
gacacctacggcctgcacctgccgctgctggcgggcaccgaagtggcgattggctttgag
gatggtaatccggacaggccgtacatctccggtgtgctgcacgactcggcccacggcgac
catgtcaccattcagaactacaagcgcaacgtcctgcgtacgccagcaaacaacaaaatc
cgcctcgatgacgagcgcgggaaagagcatattaagatcagcacggagtacggcggcaag
agtcagctgaatctcgggcatctggtcgacagcgagaagcagaagcgcggtgagggtttt
gaactgcgcacggacagttggggcgcgattcgggcacagaaagggatatttatctcggcg
gacggacaagcaaaggcgcagggcgacgttctggcgatggagcaagcgattagcctgttg
aaaggtgcggtaaatcaggttgcagaatgggaggagcttgcaaggacccaccaaaacttt
gcaccggatacacaaccccttcaggcgcttgtttcaggagccagcgtactcaaagaaccg
actttgttgatgtctgcgccgaaaggtattgccgccgtcacacccgaaacggcagtggtg
catacagggaaaggtctgtacctgcaaagcctgggtgaagttaatctcaacacggcacag
cgctattcggtcaatgccaaacaggccatttcggtgatggcgcatcaggaaggcattcgc
ctggtctctgccaaaggcccgctggcggtggaatctcacgcggatacgctgtcgctcaca
tcaatgaaggatgtcacggtgcagtctacccaagggcacctgcaactgacggcaaagaat
gggatcacgcttgcctgcggtggcgcttacatcaagctcacaccacagggcgaaatcaac
gtgcatggcccaggcctgttaagcctgaaagggcagcacaaattacagggcccggcgagt
gaggattatccgctgccagaattgccttcgtcagtatgcaaagagtgtctgaaaaaggcg
cagcggctggcacagggctttgtgccaaggggggcataa

DBGET integrated database retrieval system