KEGG   Enterobacter soli: Entas_1939
Entry
Entas_1939        CDS       T01604                                 

Definition
(GenBank) type VI secretion-associated protein, VC_A0119 family
  KO
K11910  type VI secretion system protein VasJ
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1939
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1939
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: AEN64677
Position
2086894..2088495
AA seq 533 aa
MSTLQNLVAACQADHAQLREQAQTRTDNWQPWLTPVSAASPTGEDPGYDDDFQRIREEVN
KLSGIDTGLICTLAEKLLTTTAKDIRIATYYCWARLHQDGEAGFAEGLELLAGLLQRYGM
QLHPQRDRSRKAALEWLAGTRVLDSLSLFPEVVREGAQRTTGALLLINTSLETEPEASRP
ELNTLYSGLESRLMKAGGVDAVVPQNAGNKVQSQASTHTAESDTPVLSRITSGQDLLAQA
RILTGFLREQPDGWLAAHRLMKSLRHDTLRVIPAPDAEGKTRIEPPRADQRAMLKRLYLQ
QSWLEILEQADSTFSRGANHLWLDLQWYIHQALVKLGQDVLADIIIADLKGLLRRLTGLE
TLAFNDGTPFADEITLNWINQSVLDDMPCWRDEPVSAISTGDNDILALEPEALEKADSEG
LDATLHWLQTRPGTDSTKEKWLLRLLMARVAEQKGKNELALHLLGELDSAAQSITLTQWT
PALLFEVKSRRLRLLRMKATRSETDKSRLQPEMDQLLAGLIALDPASSAVLCG
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgagcacactgcagaatttggttgccgcctgtcaggctgaccatgctcagcttcgggaa
caggcgcagacgcgcacggataactggcagccctggcttactccggtaagcgctgccagt
ccgaccggggaagacccgggatatgacgatgattttcagcgcatccgcgaagaggtcaat
aagctctccggcattgataccggactgatctgtacgcttgccgaaaaactgctgacaacc
acggccaaagacatccggattgctacctactactgctgggcgcgcctccaccaggatggc
gaagccggctttgccgaaggacttgaactgctggcgggattactgcagcgctacggcatg
cagcttcacccgcagcgggaccgcagccgcaaggctgcgctggaatggctcgccggtacc
cgtgttctggacagtctgtcactgttcccggaggtcgtacgagagggtgcacagcgtacc
accggggccttactgctcatcaataccagtctggagacagagccggaagcatcgcggcca
gagctgaataccctgtacagcgggctggagtctcgcctgatgaaggccggtggtgtggat
gccgtagtaccgcagaacgcaggtaataaggtgcagtcacaggcctccacgcatacggcc
gagtcagatacgccggttctgagccgcattacctccggtcaggatttgctggcccaggcc
cgtattctgacgggatttctgcgtgagcagcccgatggctggcttgctgcacaccggctg
atgaaaagcctgcgtcatgacacgctgagagtgatccctgcaccggatgccgaagggaaa
acgcgtatcgaaccaccgcgggctgaccagcgggccatgctcaaacggttgtatctgcag
cagagctggctggagatactggagcaagcggacagcactttctcgcgtggcgctaatcac
ctctggctggatttgcagtggtatatccaccaggcgctggtgaaactggggcaagatgtg
ctggccgacatcatcatcgccgacctgaaagggctgctgcgacgcctcaccgggcttgaa
acgctggcctttaatgacggaacgccgtttgccgatgagatcacgctcaactggataaat
cagagcgtgctggacgatatgccctgttggcgggatgaaccagttagtgctatcagcacg
ggtgacaacgatattctggcgcttgaacctgaagcgctggagaaagcagacagcgaaggt
ctggatgccacactccactggctgcagacgcgtccgggcaccgactccacaaaagaaaaa
tggctgctgcgtttgctgatggcccgcgtggccgagcagaagggtaaaaatgaactggcg
ctgcatttgctgggtgagctcgatagtgccgcgcagtcaatcaccctcacgcagtggaca
ccggcgctgttatttgaagtgaaatcccgtcgccttagactactgcgtatgaaagcaaca
cgcagcgaaaccgataaatcacgccttcagccggagatggaccagcttctggccggtctg
attgcgctcgacccggcaagcagtgcggtgctgtgcgggtaa

DBGET integrated database retrieval system