KEGG   Enterobacter soli: Entas_1940
Entry
Entas_1940        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1940
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1940
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEN64678
Position
2088539..2090293
AA seq 584 aa
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSMSVVEFTPDWREMKEQMRIVKGFEVNSRPIG
EKGTRCRYTTTKEITLQPLSLEHARLSTDSDGRSVISLRFNCSHLADWSRVDLSQIPFYF
NADAPLACAMHEAFTMNTARLWLRMPGDTDRKPLDGYFTALGFGDDDDLWPKGSSSFSGY
QLLLEYFTFREKFMFTGLRGLESVAFPAELPWFEIDVVLADRWEHDFSFTEKHLRLNCVP
VINLFPLESDPLTLNSLQTEYMLRPMRVQDGHTEIYAVDSVMSSSQHTYVPFSSFRHKGG
MMRHEAPEYYYHTRVRRGPSGLHNTWLILGGEAFDSHTVPENESLSLMLTGTNGQLPRRA
LQSTVLDTVMKTTSASIAVRNLCAPTLPCYPPDQDRFHWRVLSHLGSSFLSMMDNADVLR
GTLALYEWTDSEMNRRRLEAIIDVKHSETERFEQGYLVRGVQIEVTLDSHGFAGRGDICL
FGEMLSRFFALYTDIYLFNRLIIILQPTGERLEWEEKHNRRIPG
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatgacttaaccctgcgttattacgacgccgaaatgcgatacctgctggaagctggc
gaagagttcgcccgcgctcaccccgagcaggcggcaatgctcaatctcgataaagcgggg
gcgcgcgacccgtacgtagagcgcctgttcgaaggctttgctttcctgatgggccgcctg
cgggagaagcttgacgacgacctcccggaactgaccgaagggctggtgagcttactgtgg
ccgcattacctgcgcaccattccgtcgatgtcggtggtggaattcacccctgactggcgc
gaaatgaaagagcagatgcgtatcgtcaaaggctttgaggtaaactcgcgtccgataggg
gagaagggcacgcgttgccgctacaccactaccaaagagatcacccttcagccgctgtcg
ctggaacacgctcgcctgtcgaccgactctgacgggcgttcggttatcagcctgcggttt
aactgcagccaccttgccgactggagccgtgtcgatctcagtcaaatcccgttctacttc
aatgccgacgcgccgctggcctgcgccatgcatgaagcctttaccatgaacactgcgcgc
ctctggctgcgtatgccgggtgacacggacagaaagccgctcgacggatatttcactgcg
ctgggttttggcgatgacgatgacctgtggccgaagggaagcagcagctttagcggctat
cagctgctgctggagtatttcaccttccgcgagaagttcatgtttacgggcctgcgtggt
ctggagagcgtggccttcccggctgagctcccctggtttgaaatcgacgtggtactggcg
gatcgctgggagcatgacttcagctttaccgaaaagcatctgcgcctgaactgcgtaccg
gtgattaacctgttcccgctggagtctgacccgctgacgctcaactccctgcaaaccgaa
tacatgttgcgcccgatgcgggtgcaggatggccataccgagatatatgcggtcgattcg
gtaatgtcatcaagccagcatacctacgtgccgttctcgagcttccgccacaagggtgga
atgatgcgccatgaggccccggaatattactaccacacccgcgtgcgacggggtccatcc
gggctgcataacacctggcttatccttggtggagaagcgtttgatagccacacggtaccg
gaaaatgaaagcctgtcgctgatgctcaccggcactaacggccagctgccacgtcgcgcg
ctacaaagcacagtgctggatacggtgatgaaaacgacctcagccagtattgccgtgcgc
aacctttgtgcgccgacattaccctgttacccgccggatcaggatcgcttccactggcgc
gtgctgagccaccttggcagcagttttctgtcgatgatggacaacgctgacgtgcttcga
ggcaccctggcgctgtatgagtggactgatagcgagatgaaccgccgccgtctggaagcg
attatcgacgtaaagcacagcgaaaccgagcgctttgagcagggctacctggtgcgcggc
gtgcagattgaggtgacgctcgatagtcacggctttgccggacgtggggatatctgcctg
tttggtgaaatgctgagtcgcttctttgcgctatacaccgatatctatctgtttaaccgc
ctgattatcatcctgcaaccgaccggagaacgcctggaatgggaagagaagcacaatcgc
cgtattcccggctga

DBGET integrated database retrieval system