KEGG   Enterobacter soli: Entas_1941
Entry
Entas_1941        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1941
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1941
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AEN64679
Position
2090257..2091342
AA seq 361 aa
MGREAQSPYSRLTPRLEADLNRINFYRFCQLLEKLNPDRPLMGSTSHPGDDPVRFAPHPG
MGFPASELKAVEYDEEDDGKPPVVRTTFMGMYGVDSPLPTAYLDDISQRREGHEALQSFL
DIFSHRILTQFYRIWRKYSYPATFEPGGTDSISQSLLGLVGLGIPGTANHIATPVSRFLS
LLGVLQQPGKTQEGMQALVSLLAPETTVRVSPYCLRPVEVSRPLGFYGDDEFLLDGNTPL
GDEAMDANSQLLIALFTDNEQESQGWKPDSLLYQDFLVMLRVYLGWRFKAKITLTARTRL
LAAPPLGDGPFWLGMNGVLGAEDEDLPEDIPQTFTTELGYYAGLEPATPQQGNRRVTYKF
N
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgggaagagaagcacaatcgccgtattcccggctgaccccgcggctggaagctgatctt
aaccgtataaatttttaccgtttctgccaactgctggagaaactgaatccggaccggccg
ctgatgggctcaactagccatcctggtgacgacccggtgcgctttgcgccgcaccccggg
atgggctttccagcgagcgagctgaaagcggtggaatatgacgaagaggatgacggcaag
ccgccggtagtacgcaccacctttatggggatgtacggtgtggattcgccgctgccgacc
gcctatctcgacgacatctcccagcgccgggaagggcacgaggcgttgcagagtttcctc
gatatcttcagccaccgcatcctgacgcagttttaccgcatctggcgtaaatactcttat
ccggctacgtttgaacccggcggcaccgatagcatttcacagtcgctgcttggcctggtg
gggctgggtattcccggtacggcaaaccacattgccaccccggtgtcgcgctttctgtcg
ctgctgggtgtgctacagcagcccgggaaaacccaggaggggatgcaggccctggtgagt
ctgctggccccagagaccaccgtcagggtcagtccttactgtctgcgtccggtggaggtc
agtcgacccctgggtttttacggtgacgatgaattcctcctggacggcaatacgccactg
ggtgacgaagcaatggatgccaacagccagttgctgattgccctgttcaccgataacgag
caagaatcacagggctggaaaccggatagcctgctttatcaggactttctggtgatgcta
cgggtctacctcggttggcgattcaaggccaaaatcaccctgaccgcccgaacccgcctg
ctggccgctccgccgcttggcgacggccctttctggctcggcatgaatggtgtgctgggc
gcagaagacgaagacctccccgaggatattccacagacctttaccaccgaattgggttac
tacgccgggctggagcctgcgacaccacaacaaggaaaccgacgtgttacgtacaagttt
aactaa

DBGET integrated database retrieval system