KEGG   Enterobacter soli: Entas_1945
Entry
Entas_1945        CDS       T01604                                 

Definition
(GenBank) ImpA domain protein
  KO
K11911  type VI secretion system protein VasL
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_1945
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_1945
SSDB
Motif
Pfam: VasL ImpA_N FANCI_S3
Other DBs
NCBI-ProteinID: AEN64683
Position
2092908..2094293
AA seq 461 aa
MNDIIPRKIKTGGDPRTLPDYDALRDELSKLAHPARPDVNWQSVEKRCLSLFEQNGVELQ
TAAWYTLARTQLAGLVGLNEGLAILEALISHQWGVLWPQPVHARMEILSSLSQRLQQRMR
SLPLNYNDLSQLYRAEQLLTGLGEVLQRLELKHLSQLDTLRTLMHNSAVRLENLDDVTRS
GATIQSGNVLPATEIHGVGISSGARASSTPDDTPGNAMKWVYVAQQEQQTNVDVLTALPA
PVKKWKSFVAGMGTMLVIGPLAVWGWLFLHRPDPLETQLAASLTPLPATLTPEQLDVLRQ
QSPLSQTVITQTQQQLARLEKLPPDWNITYSRKLTEQALMLWPEQAKPLVQQWQQQLHAS
ALPTEQLNGWYQGMTTLQKLSDRLNGLDEQKGKYMTVSELKSVVFSIRQSFNQSIPAEEQ
LRVLSGNPAGDPLSAAAQSQLEMHLKQLAARYAEIKQKASE
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaatgacattattccacgtaaaataaaaaccggtggcgatccgcgcacgctgccggat
tatgacgccctgcgtgatgaactgagtaagctggcccatccggcgcgtccggatgtgaac
tggcagtctgtcgaaaaacgctgtctttcactgtttgagcagaacggggtggagctacag
acagcggcctggtatacgctggcgcggacgcagctggccggcttagtcgggctcaatgaa
gggctggcgatactcgaggctctgattagccatcagtggggcgtactttggccgcagccc
gtccatgcccgcatggaaatcctcagcagtctgagtcagcgcctgcagcaacggatgcgc
tcgcttccgctcaattacaacgaccttagccagttgtaccgggcagaacagttacttacg
gggctgggagaggtgctgcagcgcctggagcttaagcatctcagtcagctcgatacgttg
cgtactttgatgcacaacagtgctgtcagattggaaaacctcgatgacgtaacccgctcc
ggggcgaccattcagtcgggtaacgtgttgcctgctaccgaaatacatggtgtcgggatc
tcgtcaggcgcccgcgccagtagtacgcctgacgatacgccaggcaacgccatgaagtgg
gtgtacgttgcgcagcaggaacagcaaacgaacgtggacgtgctgacggcactgcccgcg
ccggtaaaaaagtggaaatcctttgttgccggcatgggtaccatgctggtgatcggcccc
cttgccgtgtggggctggctgtttcttcaccggcctgatccgttagaaactcagcttgcc
gcatctctgacaccgttacctgcgacactcacccctgaacagctggatgtgttgcgtcag
cagtcgccattatcacaaaccgtaattacacaaacccagcagcagcttgcccgactggag
aaattgccgcctgactggaatattacttacagccgaaaactaacagaacaggcactgatg
ctgtggccggaacaggctaagcccctggttcaacagtggcagcaacaacttcatgcttcc
gcactacccacagaacaactcaatggctggtatcaggggatgacaacgttacaaaaactg
agtgaccgcctgaacggacttgatgagcagaagggcaaatacatgacggtcagcgaactg
aagtccgttgtattttccatccgacagtcttttaaccagtccattccggcggaagagcaa
ctgcgtgtattgtcaggaaaccccgctggagaccctttatctgccgcagcgcagtctcaa
ctggagatgcatctgaaacaactggcagcccgctatgctgaaataaaacagaaggcatca
gagtga

DBGET integrated database retrieval system