KEGG   Enterobacter asburiae LF7a: Entas_2031Help
Entry
Entas_2031        CDS       T01604                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00071  Fatty acid degradation
eas00280  Valine, leucine and isoleucine degradation
eas00281  Geraniol degradation
eas00310  Lysine degradation
eas00360  Phenylalanine metabolism
eas00362  Benzoate degradation
eas00380  Tryptophan metabolism
eas00410  beta-Alanine metabolism
eas00627  Aminobenzoate degradation
eas00640  Propanoate metabolism
eas00650  Butanoate metabolism
eas00903  Limonene and pinene degradation
eas00930  Caprolactam degradation
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
eas01212  Fatty acid metabolism
Module
eas_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Entas_2031
   00650 Butanoate metabolism
    Entas_2031
  Lipid metabolism
   00071 Fatty acid degradation
    Entas_2031
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Entas_2031
   00310 Lysine degradation
    Entas_2031
   00360 Phenylalanine metabolism
    Entas_2031
   00380 Tryptophan metabolism
    Entas_2031
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Entas_2031
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Entas_2031
   00281 Geraniol degradation
    Entas_2031
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Entas_2031
   00627 Aminobenzoate degradation
    Entas_2031
   00930 Caprolactam degradation
    Entas_2031
Enzymes [BR:eas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Entas_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEN64767
UniProt: G2S1X7
Position
2183288..2184055
Genome map
AA seq 255 aa AA seqDB search
MSELIVTRHGRVLQLTLNRPAARNALNNALLTQLATELEAAAVDSGISACVIYGSEGCFA
AGADLNEMAEKDLPATLNDIRPQLWARINAFPKPLIAAVNGFALGAGCELALLCDVVIAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKSLASKMVLTGESITAQQAQHAGLVSDIFPA
PLTLEYALKQAALMVRHSPLALQAAKQALRQSQEVPLQAGLAQERQLFTLLSATDDRREG
IEAFLQKRTPDFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgattgtcacccgtcatggccgtgtgttgcagctcacgctcaaccgcccg
gccgcgcgcaatgccctgaacaatgcgctgttgacccagttggccactgaactggaagcc
gcggcggtagatagcggtatctcagcctgcgtgatttacggcagtgagggctgctttgcc
gcaggcgccgatctcaacgaaatggcggaaaaagatctgcccgccacgctgaatgacatt
cgcccccagctgtgggcgcgaatcaacgcctttcctaaaccgctgattgccgccgttaac
ggctttgcgctgggcgcgggctgtgagcttgcgctgttgtgcgatgtggttatcgccggt
gataacgcccgattcgggctgccggaaatcaccctcggcattatgccaggtgctggcggt
acgcagcgccttattcgcagcgtggggaaatcgcttgccagcaaaatggtgctgaccggt
gaaagcattaccgcgcagcaggcgcaacacgccgggctggtgagcgatatcttccctgcg
ccgctgacgctcgaatatgccctgaagcaggcggcgctgatggttcgccactcgccgctg
gcgctacaggctgcgaaacaggcgctgcgccagtctcaggaagtgccgctacaggccggg
ctggcgcaagagcgacagctgtttacgctactttcagccactgacgatcgccgtgaaggt
atcgaggctttcttacaaaaacgcacccccgactttaaaggacgctaa

DBGET integrated database retrieval system