KEGG   Enterobacter soli: Entas_2147Help
Entry
Entas_2147        CDS       T01604                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Entas_2147
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Entas_2147
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Entas_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AEN64881
Position
2325798..2326784
Genome map
AA seq 328 aa AA seqDB search
MTNIIAVTMGDPAGIGPEIIIKSLTEGELSGSPVVVVGCARTLQRVLEKGITTQADIRII
EKVSDAQFAPKVINVLDEPLAEPDALKPGVVQAQAGDLAYRCVRRATELAMAGDVKAIAT
APLNKEALHLAGHHYPGHTELLAHLTDSKDYAMVLYTDKLKVIHITTHIALRKFLDTLNQ
DRVKTVIGIADTFLKRVGFSNPRIAVAGVNPHAGENGLFGDEEIKIVGPAVEAMKAQGLN
VSGPCPPDTVFMQCHEGMYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKSESMTVSIQLAMQITRE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgactaatattattgctgtaaccatgggtgacccggctggcattggcccggaaatcatt
atcaaatccctgacggagggtgagctgtcaggctcgccggtggtggtggtgggctgtgcc
cgcacgctgcaacgggtactggaaaaagggatcacgactcaggccgacattcgtattatc
gaaaaggtcagtgacgcgcaatttgcaccgaaggtcattaacgtactggatgaaccactg
gcagaaccggatgcgctaaagcctggcgttgttcaggctcaggctggcgatctggcttat
cgctgcgtgcgtcgtgccaccgagcttgcgatggctggggacgtaaaagccatcgccacg
gcaccgctgaacaaagaggcgctgcatctggcggggcaccactatccggggcacaccgaa
ttgctggcgcatctgactgacagcaaagattacgccatggtgctgtataccgacaaactg
aaggtcattcatatcaccacgcacattgccctgcgtaaattccttgataccctcaatcag
gatcgggtaaaaaccgtgattggtattgccgataccttcctgaaacgcgtcgggttttca
aacccgcgcatcgccgttgccggggttaatccacatgcgggcgaaaacgggttatttggc
gatgaagaaatcaagatagtcggcccggcggtagaagccatgaaggcgcaggggctgaac
gtcagcggaccgtgcccgccggatacggtatttatgcagtgtcacgaaggaatgtacgat
atggtcgttgcgatgtatcacgatcaggggcatattccattaaaattactcggtttttat
gacggggtgaatatcaccgccggattaccgtttatccgaacctctgctgaccacgggacg
gcgttcgacattgcctggactggcaaagcgaagtccgaaagcatgacggtatctatccag
ttagctatgcaaatcacacgggaataa

DBGET integrated database retrieval system