KEGG   Enterobacter asburiae LF7a: Entas_2264Help
Entry
Entas_2264        CDS       T01604                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00052  Galactose metabolism
eas00500  Starch and sucrose metabolism
eas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Entas_2264
   00500 Starch and sucrose metabolism
    Entas_2264
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Entas_2264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AEN64997
UniProt: G2S543
Position
2445375..2446775
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPRALADSHYPHWHHAPVTGLMNDPNGFVEFAGRYHLFYQWNP
LACDHKFKCWGHWSSADLLHWQHEPIALMPDEEYDRKGCYSGSAVDSQGTLTLCYTGNVK
FDDGSRTAWQCLATENADGTFTKLGPVLPLPEGYTGHVRDPKVWQHEGRWYMVLGAQDLQ
KRGKVLLFSSADLHQWNNEGEIAGYAINGLVDAGYMWECPDLFALGDQHILICCPQGVPR
EKERYLNTYPAVWMSGDFDYERAAFKHGELHELDAGFEFYAPQTMQTSDGRRLLVGWMGV
PDGEEMLQPTLANGWIHQMTCLRELEFIDGQLWQRPLRELTALRGDAHSWQNSALPLEPM
EISLETARDNALRIDFGGALTLERDASGIRLARRSLAKDETHYRYWRGEVRSLRIFIDQS
SVEIFINDGEGVMSSRYFPDYPAQLMLSGITPEAFCYWPLRRCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttccatcacgcctgcctgcgattttgcaggccgttatgcagggccagccgcgc
gcgctggccgacagccactatccccactggcatcatgcgccggtaaccgggctgatgaac
gatcccaacggctttgttgaatttgccggacgttatcacctgttctatcagtggaacccg
ctcgcctgcgatcataagttcaagtgctgggggcactggagctctgctgacctgctgcac
tggcaacatgagcctatcgcactcatgccggatgaagagtatgaccgcaaaggctgctac
tccggcagcgccgtggatagtcagggcacgctcaccctgtgctataccggtaacgtcaaa
tttgacgacggcagccgaaccgcgtggcagtgcctggcgacagaaaatgccgacggcaca
tttacgaaactcggcccggtattaccgctgccggaaggctataccggccacgtgcgcgac
ccgaaagtctggcagcatgaaggccgctggtacatggtgcttggcgcacaggatttgcaa
aagcgcggcaaggtgctgttattcagctctgctgacttgcatcagtggaataatgaaggc
gaaatcgcgggttacgctatcaacggcctggtcgacgcgggttatatgtgggagtgcccg
gacctgtttgcgctcggtgaccagcatatcctgatttgctgcccgcagggcgtgcctcgt
gagaaagagcgctatctcaacacctacccggcagtgtggatgagcggcgatttcgactac
gaacgcgcagcgttcaaacacggcgaactgcacgaactggacgccgggtttgagttttac
gccccacaaaccatgcagaccagcgacggccgccgcctgctggtcggctggatgggcgtg
ccggacggcgaagagatgcttcagccgacgctggctaacggctggatccatcagatgacc
tgcctgcgcgagctggagtttatcgacggtcagctctggcagcgcccgctgcgtgaactc
accgccctgcgtggcgacgcgcacagctggcagaacagtgccctgccgctggaaccgatg
gagatatccctggaaaccgcccgtgacaacgcgttacgcatcgattttggtggcgcgctc
accctcgagcgcgatgccagcggcattcgcctggcgagacgcagccttgctaaagacgaa
acacactatcgctactggcgcggcgaggttcgctcgctgcggatttttatcgaccagtcg
agcgtggagatcttcatcaacgacggcgaaggtgtcatgagcagccgctacttcccggac
tatccggcacagctaatgctctccgggatcacgcctgaagcattctgctactggccgctg
cgacgatgcatggtagaataa

DBGET integrated database retrieval system