KEGG   Enterobacter soli: Entas_2362Help
Entry
Entas_2362        CDS       T01604                                 

Definition
(GenBank) GTP cyclohydrolase-2
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
eas  Enterobacter soli
Pathway
eas00740  Riboflavin metabolism
eas00790  Folate biosynthesis
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas02024  Quorum sensing
Module
eas_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:eas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Entas_2362
   00790 Folate biosynthesis
    Entas_2362
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Entas_2362
Enzymes [BR:eas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Entas_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AEN65093
Position
2548598..2549188
Genome map
AA seq 196 aa AA seqDB search
MQLKRVAEAKLPTPWGDFLMVGFEELATGQDHVALVFGDISGQTPVLSRVHSECLTGDAL
FSLRCDCGFQLEAALTHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLGVDEVRLLTNNPRKVEILTEAGINIVERVPLIVGRNPKNA
HYLDTKAAKMGHLLNE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttaaacgtgtggcagaagccaaactgccaaccccatggggcgatttcctgatg
gtgggatttgaagaactggcaaccggacaagatcacgtcgccttagtttttggcgacatt
tcagggcagacgccggtgttgtctcgcgtccattcggagtgtctgacgggcgatgccttg
ttcagcctgcgctgcgactgcggtttccagctggaagcggccctgacgcacatcgcggaa
gaaggtcgtggggttctgctctatcaccgccaggaaggccgtaatatcggtctgctgaat
aagatccgcgcttatgcccttcaggatcagggttacgatacggtcgaagctaaccatcag
ctcggttttgccgccgatgagcgcgatttcaccctgtgtgcagatatgttcaagctgctg
ggcgtggatgaagtgcgtctgctgacgaacaacccacgtaaagttgagatcctgacggaa
gccggcatcaacattgttgaacgtgtaccgttgattgtggggcgtaacccgaaaaatgcc
cactatctcgacactaaagccgcgaaaatgggccatctgttaaacgaataa

DBGET integrated database retrieval system