KEGG   Enterobacter soli: Entas_3233
Entry
Entas_3233        CDS       T01604                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_3233
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3233
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3233
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEN65955
Position
complement(3460870..3461361)
AA seq 163 aa
MSVPAYIWLYHSTGILIQGGSNVLMREGAIEMQSFNHGIHIPYDNNFGKLTGTRVHDQLS
FTKELDKATPYLNRAVCKGETLQEGIIKWYRINDAGVEEEFLHIILKSVKVVAVTPVMHN
FKNTAGQMNNPAESISLAYESITWLYLDGNITYTDTWNQRVYA
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtctgtacccgcttatatctggctttatcactctaccggaatcctgatacagggtggc
tctaacgtcctgatgcgtgaaggcgcgatagaaatgcagagcttcaaccacggcatacac
atcccctacgataataattttggaaaactcaccggcacacgcgtgcacgatcagctgagc
ttcaccaaagaactggacaaggcaacaccatacctaaatcgcgccgtctgcaagggcgaa
acgcttcaggaaggtattatcaagtggtatcggataaacgatgctggcgtggaggaagaa
tttttgcacatcattttgaagagtgtgaaagtggtggcggtgactcctgttatgcacaat
ttcaaaaacaccgctgggcaaatgaataacccggctgaatccatatcgctggcttacgaa
agcatcacctggctttatctcgacgggaatatcacctatacagatacctggaatcagagg
gtctacgcgtga

DBGET integrated database retrieval system