KEGG   Enterobacter soli: Entas_3845
Entry
Entas_3845        CDS       T01604                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_3845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3845
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3845
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AEN66555
Position
complement(4132022..4134079)
AA seq 685 aa
MADSTGLQYTFVANSLSASTLSVVAFELKEGLSEPYELSLELATQHDDIAFPRVLDDSAE
LQIWYNGELTRRVHGLVTRFARNDTGHQRTRYSVTLRPDLWLLSLEYHSRIFQQQTPQQI
ITQLLQKTGISAFHFSLRHDHPVREYCVQYRESTLDFISRLAAEEGISWYFRFTGNAHEV
VFIDDYTFLPKGEALPWNSHKRGLNEGASVQRFSYEENLRVSQVLLKEYTFKNPAWAMLY
REQGNKAPYRHHQMQHYDYPGRYKTDFNGDAYSGYRLDALRRDAMQAHGVSDSPSLTAGD
CFSLTSHPHDDFNRVWQIVSLHTTGQQSQSQEEEAGVKGTWLESHFTVIPDKLTWRPQPN
PRPRVDGPQIATVVGPEGEEVWCDEVGRVRVQFPWDLEGENNENSSCWIRVAQGWAGSRY
GAMAIPRIGHEVIVSFLEGDPDQPIITGRTYHVVNVPPHSLPVHKTRTVLRTDTHKGAGY
NELSFEDENDNQLIYFHAEKDFQTKVKNNEYLVVEQDRFATIHHDQREEVKNDKTSIVEH
DHIERVHHDQMINVIHNQQIQVDNQYLFHVLNQRKDTMGADYTEETAGDHHHSVAGWYEM
QAGKKVTVTTRELQLIGSEKVVIQGPNGKIVMDSSGISISSSQLKINAMTKITASASSAL
NSLDVAAMNGDPLSEICPICKQSLS
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggcggacagtaccggccttcagtacacctttgtcgcgaattccttatctgcaagcaca
ttaagcgtcgttgcgtttgagctaaaagaggggctgtctgaaccctatgaactaagcctt
gagctggcaactcagcatgatgatatcgctttccctcgcgtactggatgatagcgctgaa
ctacaaatttggtataacggcgagttaacgcgacgggttcacggtttagtcacgcgattt
gcccgcaacgataccggacatcagcgcacgcgttacagcgtgacactccggcctgacctg
tggttactttctctggagtaccactcccgtatttttcagcagcaaacaccacagcaaatt
attacgcaattgttgcaaaagacagggatctcggcatttcatttttctctgcgtcacgat
catccggtacgcgaatactgtgttcagtatcgtgaatccacgctggattttatctctcgc
ctcgcggccgaagaggggatctcatggtatttccgctttacgggaaacgcccatgaggtg
gtctttatcgatgactacaccttcttaccaaaaggggaggcattgccctggaattcccac
aaacgaggccttaatgaaggtgccagcgtacaacggtttagctatgaggaaaatttacgc
gtttctcaggtactgctaaaggaatacaccttcaaaaaccctgcatgggcaatgctctat
cgtgagcagggtaataaagcgccgtatcggcatcatcagatgcagcactatgattacccc
ggtcgctataaaacggattttaacggtgacgcttacagtggctatcggctggatgcacta
cgccgagatgcgatgcaggcacacggtgtttccgattccccatcgttgacggcgggtgat
tgcttctccctgacgtctcatcctcacgacgattttaaccgcgtctggcaaattgtgtcc
ttacataccacgggtcaacagtcgcagtcccaggaggaagaggcgggggttaaggggaca
tggcttgaaagtcatttcaccgtgatcccggataaattgacctggcggccacaacccaat
ccgcgtccacgcgttgatggacctcaaatcgctacggttgtggggccagaaggcgaagaa
gtctggtgcgatgaagtagggcgcgtgcgcgtccagttcccctgggatctggaaggcgaa
aacaacgaaaacagttcctgctggatccgcgtggcacagggatgggcagggagtcgttac
ggcgcaatggccatcccgcgtattggtcatgaagtgattgtgtcgttcctggaaggcgac
cctgaccagccgatcatcaccggcagaacatatcacgtcgtgaatgtcccacctcattcc
ttgccagtgcataaaacccgtaccgtattgcgtactgacacgcataaaggggctggctat
aacgaattgtcatttgaagatgaaaatgacaatcagctgatctatttccatgcggaaaaa
gattttcagaccaaggtcaaaaacaatgagtacctcgttgttgaacaggatcgttttgcc
actatccaccatgaccagcgggaggaggtaaaaaacgataaaacctccatcgtcgaacac
gatcacatagagcgtgttcatcacgaccagatgatcaacgtcatccataaccagcaaatt
caggttgataaccaatatctctttcatgtgcttaaccagcgtaaagacacgatgggggcc
gattacaccgaagagacggcgggcgatcaccaccatagtgttgcgggctggtacgagatg
caggcggggaaaaaagtcaccgtcaccacccgagaattacagctcattggctcggaaaaa
gtcgtgattcaggggccaaacggcaagattgtcatggacagcagcgggatatcgatatcc
agcagccagctcaaaatcaacgccatgacaaaaattactgccagtgccagcagtgcgctc
aactcgcttgatgttgccgcaatgaatggcgatccactctcggaaatttgcccaatctgt
aaacaatcattgagttaa

DBGET integrated database retrieval system