KEGG   Enterobacter soli: Entas_3848
Entry
Entas_3848        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_3848
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3848
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3848
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C DUF802
Other DBs
NCBI-ProteinID: AEN66558
Position
complement(4135929..4139588)
AA seq 1219 aa
MYFINKIASWLSPLRAMKVFAGKLLQLKPLLPRFSLSLTLLWLIWGMGLLAIWLWGPLWT
WGEIKPLGSAGNRIVATLLLLLLGLSAVSWYLYKQVQRALPGQQAAENLPYQASIDHQAR
FLDEWLQHYSQRSHLKNAMYSRPWYMMIGESISGKSTLIRKSDQVIPLNFQSELKREMSD
GKALKSLGLFLTQSAVLIDPPGEFFQQDEHDKDKEHHRGRRLLQHLLDWLITHRPRQPLN
GVVLTINIQELMAMTAENRRMWAQRWQTQILALSDRFACRVPVYIVINKIDVLNGFEAIY
PALSQQMRNKTLGVSFSLEAEQGDSWRKELKVFWEEWQQNLNQLMPEQMINGTTIDLRTA
LFCFIGQLSALQAVTVETINDLLRHYNRDPGRQMLIRGLYFTSAIQQNRRSDFFQDAIAE
RYGLRTTTQGVWQPKDNQSGYFLHDLFSNTLFSEPNLAGENYEFTRLRRHQLTLATVIAG
GVALSLLSGWYYYYLKNYRAGEIALKKVETFQKIGSPDVSKPLGADWLPHMDIIRDATLS
YGDYHEKNSLFSDMGLYQGDRIGQLVEKTYLRFLTQRFLPQLMTDLQKQLEAAPDNRDEK
LALLRIMRMLEDKSGRSIPLVEEYMRGRWQNAFTGQREVQERLMQHLDYALQHTDWAGDR
RKGDRDAIKAWEPFVGHVQSAQRELSRLPLYQRVYQNLGIKAREQLPPDLDLRTEIGAQF
DTVFVADEEALLKIPQFWTRYGLGHYLTTQMGRLVDITRLDAWVLKLTEHTDYSEADKRE
IQRQITDRYVGDYVSRWRNALTNLSIRPFADISEATDALDAVLNNGQPIWRALLLLRDNT
QTQLQAAIVDPDIPVAGSAKKEQKVAQVLNIAQKNTLEQMENQPDYILLNRIGRSFTEQK
ALVEHSDDQNGQLRQAYNALTAMNAELHRISNAPEPGKAALLLVQMRFQQNNADTFFTAK
QMSRNLSDPLGRWVGQLADNSWETVMGLALQSLEKEWSGKVVTPFLSQLADKYPFNRRAT
KDVALSDMERFFAPDGVIDSFYKDNLKVFVEGRASAVDGKSVIRPEIVRSLQQADKIRSI
FFSKQNGFSIQYAISPIELSANKRRAVLNLDGQLIDYTQGNPTTAHLVWPNAMRSGNESK
ITLVPNAVGASPRSIGYSGPWATFHILDKGELTSIQDGSFDIRFTVDGGAVSYRVYMDAS
DNPFAGDIFSQFTLMDQLY
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgtattttataaataaaatcgccagctggctgtctccattgcgggcaatgaaggtattc
gcaggcaaattattacaacttaaacctctgttaccccgtttttcattgtctttgacgtta
ctctggttgatatggggaatggggctgcttgccatttggttatgggggcctctgtggaca
tggggagaaataaaaccgctgggatcggcaggcaatcgcattgtggcaacgttgcttctt
ttgctgctggggctgagtgccgtcagttggtatctctataaacaagtgcagcgtgcctta
cccggtcaacaggcagcagaaaacctgccttatcaggcgagtatcgaccatcaggcgcgt
tttcttgatgaatggctgcagcactattcccagcgtagccacctcaaaaatgccatgtac
agccgcccctggtacatgatgataggggagagtatcagtggcaaaagtaccctgatccgc
aaatccgatcaggttattccgctcaacttccagagtgagctgaagcgagagatgtccgat
ggcaaagcgcttaaatcgctggggctgttcttgacccagtctgctgttctgatcgatcct
cccggggaattcttccagcaagatgaacacgataaagacaaagagcaccatcggggcagg
cgattactgcagcatcttctggactggttaatcacgcatcgtcctcgccagccgcttaat
ggtgtggttttaacgattaacatccaggaattgatggcgatgacggctgagaatcgccgt
atgtgggcgcaacggtggcaaacccaaattctggcgctaagcgatcgttttgcatgccgc
gttccagtctatattgtcatcaataaaatcgatgtactgaatggttttgaggcgatatat
cctgctttatcgcaacaaatgcgcaataagacccttggggtttcattctctttagaagcg
gaacaaggagatagctggcgtaaagagcttaaagtgttttgggaagagtggcagcaaaat
ctaaatcagctgatgcctgagcaaatgatcaatgggaccacgatcgatctccgcacggcg
ttgttttgctttataggtcaactttctgcgctgcaagcagtgaccgtagagaccatcaac
gatctcttaaggcattacaatcgcgatccgggcagacaaatgcttatccgtggcctctat
tttacgtcagcaatccaacaaaacagacgcagtgacttcttccaggatgccattgcagaa
cggtatggattacgtacgacgacgcagggcgtctggcaaccaaaagacaaccagagcggg
tattttcttcacgatcttttttcgaacactcttttctctgagcctaatcttgccggtgag
aactatgaatttacgcgcttgcgccgccatcagttaacacttgcaacggtcattgccggt
ggggttgcattgtcgctgctcagtggctggtattattactatctcaagaattatcgcgca
ggtgagatagcccttaaaaaagtcgaaacctttcagaaaatcggctcgcctgatgtcagt
aagcccctcggtgccgactggttaccgcacatggatattattcgtgacgctaccctgtct
tatggcgattaccatgagaaaaactcgctgttttcagatatggggttatatcagggagac
agaattggacaactggttgaaaagacctatctccgttttctgacgcagcgttttttgccg
cagctcatgaccgatctgcagaagcaactggaagctgctccagataacagggatgaaaaa
ttagcgctactgcgcattatgcgcatgctcgaagacaaaagtgggcgcagcattccgctt
gttgaagagtacatgcgtggacggtggcaaaatgcatttaccgggcagcgagaggtgcag
gagcggctgatgcagcacctggactacgcattacagcatactgactgggcgggagatcga
cgtaagggcgatcgcgatgcgattaaagcctgggagccgtttgtcggccatgtccaaagt
gcccagcgcgaactgagtaggctcccgttataccagcgtgtttatcaaaacctgggtatt
aaggctcgggagcaacttccccccgatctcgatcttcgcactgaaattggggcgcagttc
gatacggtctttgtcgcagatgaagaggcactgttgaaaatccctcagttctggacgcgc
tatggcctggggcattacttaaccacacaaatgggtcggttggtcgatatcactcggtta
gatgcatgggtgttaaaactgactgagcatactgactacagtgaagcggataaacgggag
atccagcgtcagattaccgatcgctatgttggcgattatgttagccgctggcgcaatgcg
ctcacgaatctctctattcgaccttttgccgacatctccgaagcgacggatgcgttagat
gccgtattgaataacgggcagcctatctggcgagccttactgctgttaagggataacacg
caaactcagcttcaggccgctattgtcgatcctgacattcctgttgccggctcggctaaa
aaggaacaaaaggttgcgcaggtgctcaacattgcgcagaaaaatacgctggagcaaatg
gagaatcagcccgactatatattactcaaccgtattggtcgctcctttacagaacagaaa
gcactggtcgagcacagtgacgatcagaatgggcagttgcggcaggcatacaatgcgcta
acagcaatgaatgccgaattgcatcgcatcagcaacgccccagagcccggcaaggcggcg
ctgctactggtgcaaatgcgtttccagcaaaataatgccgatacattcttcactgcgaaa
cagatgtcgagaaacctctctgaccctcttggacgttgggttggccaattggcagataat
agctgggaaaccgtgatgggtcttgcattacaatcgcttgaaaaagagtggtcaggcaaa
gtggtaaccccattcctttcacaactggcagacaaatatccgtttaacagaagagcgaca
aaagatgttgctctcagcgatatggaacgcttctttgcaccggatggtgtcatcgacagt
ttctacaaagataacctgaaagtgtttgttgagggacgcgccagtgccgtggatgggaaa
tcggtgattcgccctgaaatcgtcaggtctcttcagcaagcagataaaatacgttcgatt
ttcttctcaaaacaaaatggttttagtattcaatatgctatatcgccgatagagcttagt
gctaataagcgtcgtgctgtccttaatcttgatggtcaattgattgattatacgcaaggg
aaccctacgacggcccatcttgtctggccaaatgcgatgcgctccggaaatgaaagtaaa
attacgcttgtgcccaatgcggtgggagcatcgccgcggagcataggatattctggccca
tgggcaactttccatattcttgataaaggcgaattaaccagtattcaggatggcagcttt
gatatccgcttcacagttgatggtggagcagtgagctatcgtgtttatatggatgcatcc
gataatccattcgctggagatatatttagtcaatttacattgatggatcaactttactga

DBGET integrated database retrieval system