KEGG   Enterobacter soli: Entas_3851
Entry
Entas_3851        CDS       T01604                                 

Definition
(GenBank) type VI secretion ATPase, ClpV1 family
  KO
K11907  type VI secretion system protein VasG
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_3851
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3851
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3851
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_16 AAA_5 ClpB_D2-small AAA_22 AAA_7 TniB AAA_29 RsgA_GTPase AAA_24 NACHT Sigma54_activat DUF155
Other DBs
NCBI-ProteinID: AEN66561
Position
complement(4143126..4145720)
AA seq 864 aa
MIRIEIAALVERLHPLVRRALEQAAAASVNQHATEISVIHLLNELIDAPLCDIRFIFDEY
GIDVGRAESLLHVSPLDRTDYPQSYPSFSPLLIEWLQDSWLLASTELNHKELRSGALFLV
LLTHRHRYLPVDFCRLIEGIHREQLTARLNQITKDSAENSTTDSPLSVTTPVNVGGEGSL
LSRFTTDITEAARENRLDPVLCRDEEIDLMIDILCRRRKNNPIVVGEAGVGKSALIEGLA
IRIVANQVPDQLKGTVVLSLDLGAMQAGASVKGEFEKRFKGIMQEIFDAPMPVILFIDEA
HTLIGAGNTQGGLDVSNLLKPALARGELKTIAATTWREYKKYIEKDAALTRRFQLVKVNE
PDLAQATTILRGLVARYEIAHNVLVDDEALVAAVQLSARYISGRQLPDKAIDVLDTACAR
CAINLTAPPREFTRLETRLKETEQEIHHIEREQRIGLNEYAERLGELFSLRQRLQTEREI
LEKQWDSQKTLVSEIISLRQSLLKEEASSDTALQLADREAQLITLQKTQKCLSTHVDKDQ
ISAVIAEWTGVPLQQITQNELKVITELPDFLSKTIKGQDLAIGHLHRHLLTARADLRRTG
RPLGAFLLVGPSGVGKTETVLQLTELLFGGNAWLTTINMSEFQEKHTVSRLIGSPPGYVG
YGEGGILTEAIRKKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGQLIDCKNIAFF
LTSNLGYQTIVEMSDSPEQIPDALYPELAAFFKPALLARMETVPFLPLGSEILVSIIRSK
LAELSNKLSTRFNAEIIIDEAVYQEIFDRATRKENGARMLESVIDGALLPPVSMVILQKL
SHGDTISRIHFGIEANNFTVEVES
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgattaggattgaaatagccgctcttgtagaacggttgcatcctctcgttcgtcgtgct
cttgaacaggccgcggcggcgagtgttaatcagcatgcaactgaaattagtgtaattcat
ttattaaatgaattaattgacgctcctctttgcgatattcggttcatatttgatgaatat
ggtatcgatgtcgggcgcgcagaatctttattacatgttagtcctctcgatcgtactgac
tatccgcagtcatacccttcattttcaccattgcttatcgaatggttacaggatagctgg
ttactggcgtcgacggagctgaatcataaagagctgcgtagcggagccttgtttttggtt
ttgctgacacatcgtcatcgctaccttccggttgatttttgccgcctaatcgaaggaata
caccgtgagcagttgactgccagacttaatcaaatcacaaaggattccgctgagaatagt
actactgattctcccttatccgtaactactccggtcaatgttggtggagagggctcgcta
ctttctcgctttactaccgatataaccgaggctgcacgtgagaaccggctcgaccccgtt
ttatgtcgggatgaagagatagacctgatgatcgatattctttgtcgtcgtcgcaaaaac
aatcccattgttgtcggtgaagctggcgtggggaaaagtgcgctgattgaaggattggct
attcgcatcgttgcgaaccaggtaccagaccagcttaaaggaacggtagtgctttcgttg
gatctgggggcgatgcaagcgggagcctcagttaaaggagagtttgagaagagattcaaa
gggatcatgcaggaaatctttgatgcgccaatgccagtcattttgtttattgatgaagcg
catactctgataggtgcgggcaatacgcagggagggctggatgtttcaaacttactcaag
cccgcgctggccagaggggagttaaaaacaatcgctgccacgacctggcgggagtacaaa
aaatacattgagaaagacgcggcattaacccgacgcttccagcttgtaaaagtcaacgaa
cctgatctcgctcaggcaacaaccattctccgggggttggtggctcgttatgaaatcgcg
cataacgttcttgttgatgacgaggcgctggtcgctgcagttcaattaagtgctcgttat
atttcaggccgacaacttcctgataaagctatcgatgttcttgataccgcctgtgcgcgc
tgcgccattaacctgacggctccaccccgagagttcacccggcttgaaacccgattgaaa
gaaacggaacaagaaattcatcatattgaacgtgagcagcgcataggactaaacgaatat
gcggaacgcctgggtgagcttttttcattgcgtcaacgtctccagaccgaacgggaaatc
cttgaaaagcagtgggatagccagaagacactggtttcagaaataatctccttgcgccag
tctctccttaaagaagaagcatcttccgataccgcattgcaattagcggatcgtgaagcg
cagctgattacgttacaaaaaacgcagaagtgcctttcaacacatgtcgacaaagatcag
atttcggcggtcatcgctgaatggacgggcgtacctctacagcagatcacgcaaaatgag
ctgaaagttatcacagaacttcctgatttcctttctaaaaccattaaaggtcaggatctt
gccattgggcatcttcatcgacatttattaaccgcgcgtgcagatttaaggcgaaccgga
cgtcccctgggcgcttttttgctggtggggccaagcggtgtcggtaaaacagaaaccgtg
ttacaactcaccgaactcctttttggggggaatgcctggttaacgaccatcaatatgtcg
gaatttcaggagaagcacactgtttcaaggcttattggctctcctcctggctacgttggg
tacggcgaaggcgggatcctgacagaggctatacgtaaaaagccctattcggttgtgctg
ctggatgaagtcgaaaaagcgcatccagacgtgctgaatttattctatcaagcctttgat
aaaggggagatggcggatggcgaagggcagcttattgattgcaagaatatcgcctttttc
ctgacatcaaatctgggttaccagaccatcgttgaaatgagtgatagtccggagcagata
cctgatgcgctctatccagaactggctgcattcttcaaaccggccttacttgcacgtatg
gaaactgtacctttcctcccgttaggcagtgagatattggtgtccattattcgcagcaag
cttgctgagttgtcgaataaattatccacacgatttaacgcggaaattattattgacgag
gcggtatatcaggagatttttgaccgggcaacccgcaaagaaaatggcgctcgaatgctg
gagtctgtaatagacggagcactactgccgcctgtttccatggtgattttacaaaaactt
tcccacggcgatactatcagccgtatacattttggcattgaggcgaataatttcaccgtt
gaggtcgaaagctaa

DBGET integrated database retrieval system