KEGG   Enterobacter soli: Entas_3854
Entry
Entas_3854        CDS       T01604                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_3854
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3854
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3854
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AEN66564
Position
complement(4147898..4148416)
AA seq 172 aa
MKRLSMLIAGPWLLLFSVLLSGCKNPLWPVDGTPDVSTLPSQAGLTLLADSDINPNESQA
ASPASFQVIWMSEDSKLLATDIDQLTTKKIEDVLGKNYVNHQDFTLIPGQYKYLPPVELE
KETRFIGVAVYFSQPNATQWKKVIKVSPIGHRYQILIHLHKNSVDILKESED
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaaacggttgtctatgttgatagcaggcccgtggctcctcttattttccgtcctgctc
tcaggatgtaaaaaccctctctggcctgtagatgggacgcctgatgtttcgacgcttcct
tcgcaggctgggctcacattgctggccgacagtgacatcaatcctaatgagagtcaggct
gcctcgcctgcctcttttcaggttatctggatgtcagaggactctaaacttttagccaca
gatatcgatcagcttactaccaaaaaaattgaagatgtcctcggcaaaaactacgtgaac
caccaggatttcacccttataccgggccaatacaaatatcttccgcccgtggaactggag
aaagaaacacgatttataggggtagctgtttacttcagtcagccaaatgcaacgcagtgg
aagaaagtgataaaagtttcacccattggtcatcgttatcagattttaattcatttgcat
aagaacagcgtagatatcctcaaggagagcgaagactga

DBGET integrated database retrieval system