KEGG   Enterobacter soli: Entas_3858
Entry
Entas_3858        CDS       T01604                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3858
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3858
SSDB
Motif
Pfam: GPW_gp25 SplA
Other DBs
NCBI-ProteinID: AEN66568
Position
complement(4152425..4152853)
AA seq 142 aa
MSALTAWRRSRSASLFERIEECNAARSADDTDDLVASLKRNLQAILNTRSGNAQSCPELG
IIDFNDATGSSVEVYSAMCRAIKRCIEDYEPRISRAEIIAQPNEADPLTLYFLVKAYVSL
EERESIINFNLRIDGNHKYKFE
NT seq 429 nt   +upstreamnt  +downstreamnt
gtgtctgcgcttactgcatggcgaaggagtcgttctgccagcctttttgagcgcattgag
gagtgcaatgccgccaggtctgcggatgacactgacgatctggtggcttctctaaaacgc
aatcttcaggcgatactcaacacccgctctggtaacgcgcagagttgtcccgaattaggc
attatcgatttcaatgatgcaacggggagctctgttgaggtttattcggcgatgtgtagg
gcaattaaacgatgcatagaggattatgagccgagaataagcagggctgaaatcatcgcg
caacctaatgaagccgatcctttaacactttattttttggttaaagcatacgtttcgctc
gaggagcgtgagagcattatcaatttcaatttgcgtattgatggaaatcacaaatataaa
tttgagtga

DBGET integrated database retrieval system