KEGG   Enterobacter soli: Entas_3859
Entry
Entas_3859        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, EvpB/VC_A0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3859
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3859
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AEN66569
Position
complement(4152858..4154336)
AA seq 492 aa
MIVESVNQNGELINEASSLLDHIMHQARLQPEDEGYDIAKHGISAFIANLLESGQEDVPV
NKLIVDRMIAELDKKMSAQMDEILHSDEFQNMESSWRSLKLLVDRTDFRENIKITILHAT
KEELLDDFEYSPEIVQSGFYKHIYASGYGQFGGEPVAAVIGNYAFTPSAPDMKLLQYVSS
VGAMAHAPFISSAAPAFFGLKSFTELPAIKELKAVFEGPAYVKWRALRESEDSRYLGLTT
PRFLLRLPYDSEDNPAKSFDYRETIQGEHDNYLWGNTAYLMACNLTDSFARYRWCPNIIG
PQSGGAVHDLPVHKFESLGQLQAKIPTEVLITDRREFELAEEGFITLTMRKGSDNAAFFS
ANSVQKCKVFPNTREGKIAETNYRLGTQLPYMFIINRLAHYVKVLQREQLGAWKERQDLE
RELNRWIRQYVADQENPPAEVRSRRPLRAAQITVSDVEGDPGWYQVSMAVRPHFKYMGAS
FELSLVGRLDKE
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgatagttgaaagtgttaatcaaaacggtgaattaataaatgaggcatcctcattactt
gatcacataatgcatcaggccagacttcaacctgaggatgaaggatatgatattgctaag
catggcatatcagcatttatagcgaatttactggagtcagggcaagaagatgttccagta
aataagttaatcgttgatagaatgatcgccgaactcgacaaaaaaatgagtgctcagatg
gatgagattctgcattctgacgagttccagaatatggaatcctcctggcggtcattaaaa
cttctggtggacagaacggattttagagaaaacatcaaaattacgatccttcatgccaca
aaagaagagttgttagacgattttgaatattcccctgaaattgtacaatctggattctat
aaacatatctacgcgagtggttatggccagtttggcggagagccggtagccgctgtcatt
ggtaactatgcgttcacaccctctgccccggatatgaagctcctccagtatgtcagctcc
gttggcgctatggcacatgcgccatttatctcttcggccgcaccagccttctttggcctc
aaaagctttactgaacttcctgccattaaggagttaaaagctgttttcgaaggtccagca
tacgtcaagtggcgtgccttaagagaatcagaagattcacgttatttaggacttacgaca
ccgcgtttcttgttgcgtcttccttacgacagtgaagataatccggctaaatcctttgat
tatcgtgaaaccattcagggtgaacatgataattacctgtggggaaacacggcctatctg
atggcctgtaatctgacggatagcttcgcccgttatcgctggtgcccaaatatcattgga
cctcaaagtggtggtgctgtgcatgacttaccagtgcataagtttgagtcccttgggcaa
cttcaggccaaaatcccaaccgaggtcctgataaccgaccgtcgtgagtttgaactcgct
gaagagggatttatcacgcttacaatgcgcaaaggcagcgataatgcagctttcttctcg
gcaaactcagtacagaaatgcaaagtattccccaatactcgggaaggaaaaatcgcagaa
actaattaccgacttggcactcaacttccttacatgttcatcattaaccgcctggctcac
tatgtaaaagtcctccagcgggaacagcttggtgcgtggaaagagcgccaggatctggag
cgagaacttaaccgctggattaggcaatatgttgcagaccaggaaaacccgccggcagaa
gtacgtagccgccgtcctttacgcgcagctcaaatcaccgtttctgatgtagaaggcgat
cctggctggtatcaggtgtccatggctgtgcggccacattttaaatatatgggggcgagt
ttcgaactctctctcgttggtcgtttggacaaggaataa

DBGET integrated database retrieval system