KEGG   Enterobacter soli: Entas_3860
Entry
Entas_3860        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_3860
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_3860
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEN66570
Position
complement(4154366..4154884)
AA seq 172 aa
MSKKIYEGSIAPKERINIKYVPATGDEQAEVELPLNILVVGDLKGGKEDSAIEEREGISI
NKHNFDSVMQTAGLRLNFSVKNKLQDNTDEELPISLNINALKEFSPDNVARQVPELKRLL
ELREALVALKGPLGNIPSFRASLQQLLTDGEMRAQLLKELDIALEDDSAIKE
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagtaaaaaaatatacgaaggaagcatagcacccaaagaacgtataaatattaagtat
gttccagcaacaggggatgaacaagctgaagtcgaattaccccttaacattttagttgtg
ggcgacctaaaaggtggcaaagaagactccgctattgaagaaagagagggtatctcaatt
aataagcataactttgattcggttatgcaaactgctggcctacgactgaacttctcagtg
aaaaataagttacaagacaatactgatgaagagttgccgatcagtttgaacattaatgca
ctcaaagagttttcacccgataacgttgcacgacaagttcctgaattgaaaagattactt
gagctaagagaggctctggtcgcgttgaagggcccattgggcaatattccttcgttcagg
gcaagtttacagcagttactcacagatggcgaaatgcgtgcacaacttctcaaagaactt
gatatcgctcttgaagacgatagcgccataaaagagtaa

DBGET integrated database retrieval system