KEGG   Enterobacter soli: Entas_4468
Entry
Entas_4468        CDS       T01604                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_4468
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_4468
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_4468
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: AEN67164
Position
complement(4806658..4808667)
AA seq 669 aa
MFKSTGLYFTCQIGNLSDDTLETTNFSMTEGLSELFTLSVTLVSARDDINVHEYLLQPVS
FTITVDGIDQRIINGVISAFEQGDTGFRRTYYYLTVRPTLWVLSLNQDSRIFHKKSVPQL
LDELIQPFCVQGRNLLMKESHPVHEYVTQKRESSWDFFNRLASQEGITYWFDQEGLCYSD
SRLAMHNVATLAYNPHPASLLRDNIVSQWRAGAAMQPLETIHKDRNYHNPANPLRASRAS
ADKTGSGTMFSAFESYGRFQEDGEGRSTVQYRMDRFEAGMRTGSGRTNCALLMPGTIFTL
EDHPADAMNGEWQVITTQMQGKMPEAAEEEGSGGGTTLICDFTFIPGNAQWRPPYRYKPL
ADGDEVATVVGPEDEEIYVNEDGCVRVHFHWDRYNPADENASCWIRVAQGWNGSGFGMMA
IPRIGQEVIVSYLNGDIDRPIITGFTYNGINRPPYELPGNKTKMVIRSKTHKGDGYNEIS
FEDNAGQEQLFLRAQKDLLGRVENDAQWHIVRDQHTKIERDQITELTRDRHESISGEWRS
KVEGEVSQEMGSSLNQKVAKSLISEAGQEIHYKAGSKVVIEAGMELTLKAGGMFLTINPS
GICMTGPVRINGGVAGNGSALRLLRPGIPLQIPQPPQLSPVQLETFQAEAPYCEECEKCK
DGLCDFNET
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgtttaaatccacaggcctttatttcacttgccagattggcaacctttcagatgacacc
ctggaaaccaccaatttttcaatgacagaagggctctccgaactttttaccctttcagtc
acattagtcagcgcacgtgatgacattaatgttcatgagtacttactccaacctgtttcg
tttaccattaccgtcgatggtatcgatcagcgaataattaatggcgttatcagcgctttc
gaacaaggggacacgggttttcgacgaacgtattattacctcaccgtgagaccaacgctt
tgggtccttagcctgaaccaggacagccgtatttttcataaaaaatcggtcccacaatta
cttgatgaattaattcagcctttctgcgttcagggtcgcaatctgttgatgaaagaaagt
catccggttcatgaatatgttactcaaaaacgtgaatcttcatgggactttttcaaccga
ctggcttcccaggaaggcatcacctactggttcgatcaggaaggcctctgttatagcgac
agccgtctggcaatgcataatgttgcaacactcgcctataaccctcacccggcatcgtta
ctacgtgacaatattgtgtcccagtggcgggcaggcgccgcgatgcagccgctggaaact
attcataaagacagaaactaccacaatccagcgaatcctttgcgcgccagtcgcgcatct
gcagacaagaccggcagcggcacaatgttttcagcctttgaaagctatggtcgctttcag
gaggatggcgaagggcgctctacggttcagtatcgaatggatcgttttgaggcaggaatg
cgcacaggtagcggtcgcaccaactgtgccctgttaatgccaggaaccatttttacactt
gaagatcatccagcagatgccatgaatggcgagtggcaagtgattacaacgcagatgcag
ggaaaaatgccagaggctgccgaggaagagggaagcggcggtggaaccacactcatttgc
gatttcacgtttattcccggtaacgcccaatggcgtccgccttatcgttacaaaccgttg
gcggatggtgacgaagtggcaacggttgtcggtcctgaagatgaagagatttacgttaat
gaggatggctgcgtacgggttcactttcactgggaccgctataatccagccgatgagaat
gcctcttgttggatccgcgtggcgcagggctggaacggaagcggattcggtatgatggca
attccccgcattggccaggaggtgattgtctcttacctcaacggagatattgaccgtcct
atcatcacgggtttcacctataacgggattaatcgtcctccctacgaactgccgggtaac
aaaacgaaaatggttattcgcagtaaaacccataagggagacggttataacgagatttca
tttgaagataacgctggtcaggagcagcttttcctgagagctcaaaaagacctgctgggc
cgcgtagagaacgacgcacagtggcatatcgtacgcgatcagcacaccaaaattgaacgc
gatcagatcaccgaactaacacgcgatcgtcacgagagcatatcaggtgaatggcgtagc
aaggtggaaggtgaagtttcccaggaaatggggagtagcctgaaccagaaagtcgcgaag
tcgcttatcagtgaggcaggtcaagagatccactataaagcgggaagcaaggtggtgatt
gaagccggtatggagctaacactgaaagcaggcggcatgttcctgaccatcaatccttcc
ggtatatgcatgacagggccggtgcgaattaatggcggagttgcaggtaacggttccgca
ctgcgtttattgcgcccgggcataccgctacaaattccgcagcctccacaactgtcaccc
gtccaactggaaacattccaggctgaagcgccctattgcgaggagtgtgagaagtgcaag
gatggactatgcgattttaatgaaacttaa

DBGET integrated database retrieval system