KEGG   Enterobacter soli: Entas_4615
Entry
Entas_4615        CDS       T01604                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
eas  Enterobacter soli
Pathway
eas03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Entas_4615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_4615
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_4615
SSDB
Motif
Pfam: IcmF-related_N
Other DBs
NCBI-ProteinID: AEN67294
Position
pENTAS01:complement(124597..128031)
AA seq 1144 aa
MIKKLFVFTGWLLTICMVLAFCVAGALWLEWSTLTTLFVWISILVTGVLLWGFATWLNTF
FRENTLKSFLRKFRLSRQEYVLYKLWRKGVSVIKSIQRKRTSIPWYIFMGERCGKSSLLA
GSGLPMFTNSSDDYLVTPTHTLRWWFFRNVCILDLSSNFLCGTSSFQRSWDKLVGWISRG
PAPAGIIVGIDIDDLLNDEGGILHDKARRIRSQIEPLTRRLKRQLPVYILITQCDKMDGF
KVWSQKLSISQIQQVLGHYWQESPDIDGKDDSTLYPLFENLKTGLDFARFSMSDTSMSSS
ERAILLDFPESFSRIKKSLTLFLASLCEPNVYFSAISLGGVWFTASEVQDSNKSRRTSYF
INDLLTQHLSVFSQSRDVVWYHNTKLRYFFISVFLLGTMTLLGISAVSSAKLMKGSIHSL
SQSELTNLLVKNESHQDSPLFYLPFLPVLDYQHNRIESSIVLKIRPRPRDFSYVIEEYKN
QVINANPGNQRMMILNLAQAIITYEQMLDGTKLENLNQLPAIPDELHISVTESFTTSLER
LVADRWMLRQPSGAGYIKSLRSLLASLINYDPSLMWLTAPIQYPPDINSSDYWHDLPGTV
ILSGIWTRQGEEQINVWVDLLNLALEGTQNESVLKTFLQNLPVKRQDAWRGFLLGVMPLL
QDTKPHSLSTDQLISIGEGQSSAMKFSHRINDELDNVNPSMAQSWLNELRQLQKLPSYTS
EPVMFQKARQADIQLRSKLTAWLFKGKLPVPENSVAQQIDAWKVWRLSLNNVVVQAISQA
TLSPSLTQGLFVPATKSATGNPQIALFTNFDKLRKSLHSYSQEPGIDAVWSLYRNDADLL
LAHSMARSACWLNEQWKSKVLWPMSKDASAQDYDSRQALSWQYISDFIRNSTKGLLIVSE
QGPKSGEFQGQTLPLNADFLRVARYMLNPEDILDAPEHTNTLTGDKLAIIEDQITTLTKQ
LNTLTEKIFQVTIISGPATIPEKARLVPIGSSLTLVCQNGSQIIDSMNFAEHAQFNWQPG
LCQGVKLDVKFPGFTATYRYTGNSAWPDFISDLVSGEALLDTNNFDDGIDLLEELGIKHV
LVRFKIMNQQPLQEAWSEWNSLDEKIMVLIQQQQSLKEQLEIQQPSAALRGRFSELPKNV
AECN
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgattaaaaaactttttgttttcaccggatggttactgactatatgtatggtattagcc
ttctgtgttgctggggcattatggcttgaatggagtaccctcacaactttatttgtgtgg
atatctatactagttacaggtgttttgctttggggttttgcaacatggttgaatactttt
tttagagaaaatacattaaaaagttttttgcggaagtttcgtctatcacggcaagaatac
gtactttacaaactttggagaaagggggtgtccgtgataaagagtattcagcgtaaacgt
acatctataccctggtatatttttatgggtgaacgttgtggtaaatcatctttactcgcc
ggatcaggtttaccgatgttcactaacagttcagatgattatttagttactcctacccat
acattgcgatggtggttttttcgtaatgtatgtatccttgacctttctagtaattttctg
tgcggaacatcttcttttcaacgctcatgggataagctagttggatggatatctcgaggc
cctgcacccgcaggaataatagttggcatcgacatagatgatctattaaatgatgaagga
ggtattcttcatgataaagccagaagaatccgctctcaaatagaaccacttacacgcaga
ttaaagcgacaactccctgtttatattttaatcactcaatgtgataaaatggatgggttt
aaagtttggagtcaaaaattatcaatttcgcaaattcaacaagttcttggtcattactgg
caggaatctcctgatattgacggtaaggatgattcaacactgtatccattgtttgaaaac
ttgaagactgggctcgactttgcgcgatttagtatgagtgacacttctatgtcgtccagt
gaacgagcaatccttctggatttccctgagtctttttcccgtatcaaaaagagtttaaca
ctttttctcgcatctctctgtgaaccaaatgtctatttttccgctatatctctgggtggc
gtgtggtttactgcctcagaagtacaggatagtaacaaaagtcgccgtacttcctatttc
attaacgatttactcacccagcatctctcggttttcagccaatcacgggatgttgtttgg
tatcacaatactaaattacggtatttttttatcagtgtttttttgttgggaaccatgaca
ttattaggaatcagtgcggtaagtagtgctaaacttatgaagggtagcatacattctctt
tctcaatctgaattgacaaacctactagttaagaatgaaagtcatcaggattcaccttta
ttttacttaccatttcttccagttttggactaccagcataatagaatagaatcatcgata
gttttaaaaattcgtcctcgtccccgtgatttttcttatgtaatagaggaatataaaaac
caagtcataaatgcaaatcctggtaatcaacgcatgatgatcctcaatcttgcccaagca
attattacttatgaacaaatgcttgacggaactaagttggagaatcttaatcagttacca
gctattcccgatgaacttcatatcagtgtaactgagtcgttcacaacatcacttgagcgt
cttgttgcggaccgatggatgctgaggcaaccatccggtgcaggctatataaaatccctg
cggagcttgcttgcatccctcattaactatgatccttcccttatgtggcttactgctcca
atacagtatcctcctgatatcaattcaagtgactattggcatgacttaccaggaacagta
atactttctgggatctggactcgtcaaggggaggaacagatcaatgtatgggtcgatctg
ctcaatttggccctcgaaggtactcagaatgaatctgttctgaaaacttttcttcagaac
cttcccgtaaagcggcaagatgcctggcgcggattcttactgggagtaatgcctttatta
caggacactaaacctcattcgttatcaactgatcaacttattagtattggcgaagggcag
agttcagcaatgaaattctctcatcgtataaatgatgagctcgataatgtaaaccctagc
atggctcaatcatggctaaatgagctccgccaattacagaaactaccttcatatacctcg
gagcctgttatgtttcagaaagcgcgtcaggcagatatacaacttcgtagtaaattaaca
gcttggttgttcaagggaaaacttcctgtacctgaaaattctgtcgcccaacaaattgat
gcctggaaagtttggcgtctctcgctcaacaatgttgtcgtacaggccataagtcaggct
acgctttcaccatcattaacacaggggttatttgttcctgcaactaagtctgccactggt
aatccccagatagcgttgttcactaactttgataaattgcgcaaatctttacactcctat
tctcaggaaccagggattgatgcagtctggtcgctgtatagaaatgatgccgacttgtta
ttagctcactctatggcacgctctgcttgctggctaaatgaacaatggaaaagtaaagtt
ttgtggccaatgagcaaagatgcttccgcgcaggattatgacagcagacaagctttgagt
tggcaatacattagtgattttattcgtaattcgaccaaaggattacttattgtctctgaa
caggggccaaagtcaggtgaatttcaggggcagactctcccactgaatgctgattttttg
agggtcgcgcgttatatgttaaaccctgaagatattctagatgcacctgaacatacaaat
acgttgacgggggacaaacttgcaattatcgaggatcaaataactacgttgaccaaacag
ctgaatacccttacagaaaaaatattccaagtaacaattataagtggccctgctacaatt
cctgagaaagctcgtttggtaccgattggctccagcctgacgcttgtttgccagaatggt
tcgcaaattattgacagtatgaactttgcagaacatgcgcaattcaattggcaaccaggt
ctatgccaaggcgtaaaactagatgttaaattccccggcttcactgcaacatatcgttat
acaggcaatagtgcatggcctgactttatctcagatcttgttagtggtgaggctctactt
gataccaataattttgatgatggtattgatttacttgaagaattaggtatcaaacatgta
cttgtacgtttcaaaattatgaaccaacaacctctgcaagaagcttggtctgaatggaat
agtcttgatgaaaaaattatggttcttatacaacaacagcaatctcttaaagaacaacta
gagattcagcaaccttctgcggcactcagagggagattttctgagcttcctaaaaatgta
gcagagtgcaattaa

DBGET integrated database retrieval system