KEGG   Enterobacter soli: Entas_4619
Entry
Entas_4619        CDS       T01604                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_4619
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_4619
SSDB
Motif
Pfam: ImpA_N T6SS_VasJ Glyco_hydro_130
Other DBs
NCBI-ProteinID: AEN67298
Position
pENTAS01:complement(130670..131734)
AA seq 354 aa
MKTMQQEIAVLLAPITPDVPAGKNIEYEQIYDDIRKARESDNDDVHQDMWGVADPRRADW
HKVLRLCETALTQMSKDLQVSCWFVEALTHLKGLAGAEVGLNFLGEFISRFWFQCWPALD
DEGAAFRNGKLNRLDRDLSLTLSNFQLLQVPESSLSHWRKILAFEHKIAVNPKSRDDHIA
MDGDLTMETFSRTASTFSSVELSLQAGILQGIYVNLNRLEECYFTLSQEEPQGLFLMTRK
TIDDISDFLQNLAQRISPAVSETMTWSMAPESDIPSVSDRGDFSNEIYSREKAISQMLSI
AHFFRQTEPSSPVPFLIERAVRWTNMTLSEWLEEMLSDNNSLKEINNVLKGQQQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaaaacaatgcaacaagaaatagctgtgttactggctcccattacaccagacgtaccc
gctggtaaaaatatagagtacgagcaaatttatgatgatattcgtaaagcgcgcgaaagc
gataatgatgatgtccatcaagatatgtggggggttgccgatccgcgacgtgctgactgg
cataaagtcctaagactctgcgaaacagccttaacccagatgagtaaagacctgcaagtt
tcttgctggtttgttgaggcattgacacacttgaaaggtctcgcaggtgctgaagtggga
ttaaattttcttggggagtttatttcacgtttctggttccagtgttggcctgctctggat
gatgaaggggctgcctttcgtaacgggaagcttaatcgtctcgaccgtgatctcagcctg
acactgagcaattttcagctcctgcaagttcctgaatcatcgctatcccactggcgaaag
attttagcttttgaacataaaattgctgtaaatccgaagtcacgcgatgatcatattgca
atggacggcgacttaacgatggaaactttttcccgtacagcgtccacattttcatcggtt
gaactcagcttgcaagcaggtattttgcaaggtatctatgttaatttaaaccggttggag
gaatgttattttactcttagccaggaagagcctcagggcctgttcttaatgacaagaaag
accattgatgatatttctgattttctacaaaacctagctcaaagaatatctcctgctgta
tctgaaactatgacctggagtatggctcctgagtctgatattccttcagtaagtgataga
ggtgattttagtaacgagatatattctcgagagaaagctattagtcaaatgctttcaata
gcacattttttccgtcagacagagccctcaagtcccgtaccatttctgatagaacgtgct
gtacgttggactaatatgacattgtcagaatggcttgaggaaatgttaagtgataataat
agtctgaaagaaattaataatgttttaaaaggacagcaacagtga

DBGET integrated database retrieval system