KEGG   Enterobacter soli: Entas_4624
Entry
Entas_4624        CDS       T01604                                 

Definition
(GenBank) gpW/GP25 family protein
  KO
K11897  type VI secretion system protein ImpF
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_4624
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_4624
SSDB
Motif
Pfam: GPW_gp25 HobA
Other DBs
NCBI-ProteinID: AEN67303
Position
pENTAS01:complement(136784..137197)
AA seq 137 aa
MSLLQLLSDNNPTDESDSYTEENQIKFLLDELKMLFSSRTFFTYIGDVPLVNSSILNYGI
DENMVEGNINNQQFDLIEQYIEILLSRFEPRFASVSVAINKVTIFKVYIEISAWYENYPI
KLMLDWDIERRRFNLNE
NT seq 414 nt   +upstreamnt  +downstreamnt
atgtcgttgttacagctacttagcgataacaatccaactgatgaaagtgatagctatacg
gaagaaaatcaaatcaaattcctacttgatgaattaaaaatgttgttttcatctcgcact
ttcttcacatatataggagatgtacctcttgtaaactcttctatattaaattacggcata
gatgaaaatatggtagagggaaatatcaacaatcaacagtttgacttgatcgaacaatat
atcgagatcttattatcaagattcgaaccaagattcgctagtgtctcagtggccataaac
aaagtgacaattttcaaagtttatatagagataagcgcgtggtatgaaaattaccctata
aaattaatgcttgactgggatatagaacgcaggagatttaacttaaatgaatag

DBGET integrated database retrieval system