KEGG   Enterobacter soli: Entas_4627
Entry
Entas_4627        CDS       T01604                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
eas  Enterobacter soli
Brite
KEGG Orthology (KO) [BR:eas00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eas02044]
    Entas_4627
Secretion system [BR:eas02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Entas_4627
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEN67306
Position
pENTAS01:complement(139229..139735)
AA seq 168 aa
MSNTQHKLDKARPPRVQITYDVEIGDATEAKELPLVIGVMGDFTESSDSLRDRKFVSVDK
DNFDEIMSSMMPSAEFQVESVLPGKEGYIPVSLTFNSMEDFSPASIAHQVEPLKQLLELR
EQLSDLRNRVASNERLKEQLLAIVEKENVSYSEGNQDQTKQPGDDNEQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgagtaatacacaacataaattagataaagcaagaccgccaagagtacaaatcacttat
gatgtagaaattggggatgcaacagaagctaaggaactacccttagttattggtgtaatg
ggtgatttcaccgaaagctcagacagtttgagagacagaaaatttgtcagtgtggacaag
gacaattttgatgaaataatgtcatcaatgatgccttctgcagaatttcaagtggaaagt
gtattgccgggaaaggaaggttatattcctgtatctctaacatttaatagtatggaggat
ttctcgccagccagtattgcccaccaggtcgaacctttgaaacagttgttagaacttaga
gagcaattatctgatttgcgaaaccgagttgccagtaatgaacgtctgaaagaacagtta
ttggcaattgtagaaaaggaaaatgtcagctattcagaaggaaatcaggatcaaactaaa
caacctggagacgataatgaacaatga

DBGET integrated database retrieval system