KEGG   Exiguobacterium sp. AT1b: EAT1b_0155Help
Entry
EAT1b_0155        CDS       T00897                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00010  Glycolysis / Gluconeogenesis
eat00071  Fatty acid degradation
eat00350  Tyrosine metabolism
eat00620  Pyruvate metabolism
eat00625  Chloroalkane and chloroalkene degradation
eat00626  Naphthalene degradation
eat00650  Butanoate metabolism
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01120  Microbial metabolism in diverse environments
eat01130  Biosynthesis of antibiotics
eat01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0155
   00620 Pyruvate metabolism
    EAT1b_0155
   00650 Butanoate metabolism
    EAT1b_0155
  Lipid metabolism
   00071 Fatty acid degradation
    EAT1b_0155
  Amino acid metabolism
   00350 Tyrosine metabolism
    EAT1b_0155
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EAT1b_0155
   00626 Naphthalene degradation
    EAT1b_0155
Enzymes [BR:eat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EAT1b_0155
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EAT1b_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ACQ69089
UniProt: C4L1E3
Position
130883..133474
Genome map
AA seq 863 aa AA seqDB search
MAVKEKAKVETTAEQMVDTLVASAHKALDTLMTFDQEKIDHIVQAMALAGLEQHVALAKL
AHTETGRGVFEDKMIKNIFATEYIYNSLRGEKTVGVLEDDVQNGITYIAEPVGVVAGVTP
VTNPTSTTMFKAIIAIKTRNPIIFAFHPSAQQCSSEAARVLRDAAVAAGAPENLIQWVEV
PSLDATKALMNHPGVAMVLATGGAAMVKSAYSTGKPALGVGPGNVPAYIDKTAKVKRAIS
DVILSKTFDNGMICASEQAIIVDQEVYEEVKAEMTALGCYFCSPEEKAKLETLVIRTDTC
AVNPEIVGKPAAWIAEQAGLKVPADTKILIAELETVGATELLSHEKLSPVLGAYKVQSRE
EGFAIAEKMLEIGGLGHTAVIHSTDDDAILEFGLRMKACRIIVNSPSAHGGIGDLYNEMT
PSLTLGCGSYGKNSVSENVTAKHLLNVKKVARRRVNMQWFKVPEKIYFEKNSVQYLQSLT
TKKRAMIVTDEMMVKLGFADKVIKNLPAGVEYRIFDQVEPDPSVETVMNGAEAMRHFQPD
MIIALGGGSPMDAAKGMWLFYERPEEKFSNLRQKFMDIRKRTYKFPTLGNKSMFIAIPTT
SGTGSEVTPFTVITDKKRNVKYPIADYAITPDVAIVDPEFVMTVPASITADTGMDVMTHA
IEAYVSVMANDYTDGLCLRAIKMIFDYLPKAYENGSDAEARQKVHNASTMAGMAFANAFL
GINHSIAHKIGGEFHVPHGRTNAILMPHVIRYNATRPSKLAAFPKYESFIADERYAEIAR
YLGLPASTTAEGVESLVQAIIELGQRLNIKLSFKAQGIKKAELDAKIDKMAVDAFEDQCT
TANPKMPLVEELKEIMYAAYEGV
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagagaaagcaaaagtggaaacaacggcagaacaaatggtggacacgctc
gtagcaagtgcgcataaggcactcgatacgttgatgacgttcgaccaagagaaaatcgat
cacatcgtacaggcgatggcgcttgcgggactcgagcaacacgtcgcactcgcgaagtta
gcacatacagaaacaggtcgcggtgtctttgaagacaagatgatcaaaaacattttcgcg
acagaatatatctataactcactccgtggtgagaaaacggtcggcgttcttgaagacgac
gttcaaaacggaatcacatacatcgcagaaccagtcggtgtcgtcgctggggtcacaccg
gtcacgaacccaacatcgacaacgatgttcaaagcgatcatcgccatcaagacacgtaac
ccgattatcttcgcgttccatccatcagcgcaacaatgttcaagcgaagcggctcgtgtc
ctccgtgacgcagcagtggcggcaggtgctcctgaaaacttgattcaatgggttgaagtt
ccgtcactcgatgcgacgaaagcgctcatgaaccaccctggtgtagcgatggtccttgcg
acgggtggggcagcgatggtcaaatcggcttactcgactggtaaaccagcactcggtgtc
ggacctggtaacgtaccggcctacatcgataagactgcgaaagtgaaacgtgccatctca
gacgtcatcctttcaaaaacgttcgacaacggaatgatctgtgcgtctgaacaagcgatc
atcgtcgatcaagaagtatatgaagaagtgaaagcagagatgacggcactcggttgctac
ttctgctcaccagaagaaaaagcaaaacttgaaacactcgtcattcgtacagatacatgt
gcggtcaaccctgaaatcgtcgggaagccggcagcatggatcgctgaacaggcaggtctc
aaagtaccagcggatacgaagatcttgattgcagagcttgaaacagttggcgcaacggaa
cttctttctcacgaaaaattaagcccggttctcggtgcgtataaagttcaatcacgtgaa
gaaggatttgcaatcgctgaaaaaatgctcgagattggtggtctcggtcacacggcggtc
atccactcaacagatgacgatgccatccttgagttcggtctccgtatgaaagcttgccgc
atcatcgtcaactcaccttcagcacatggtggaatcggtgacctttataacgaaatgaca
ccatccctcacgctcggttgtgggtcttacggtaaaaactccgtctcagaaaacgtgacg
gcgaaacatctactcaacgtgaaaaaggtggcgagacgtcgcgtgaatatgcaatggttc
aaagtacctgaaaaaatctatttcgagaaaaactcagtacaataccttcaatcgctcaca
acgaaaaaacgggcgatgatcgtcacagatgaaatgatggtcaaactcggattcgctgac
aaagtcatcaaaaacttgccggctggtgtcgagtaccgcatcttcgaccaagtcgaaccg
gatccatctgttgaaacggtcatgaacggtgccgaagcgatgcgtcacttccaaccagac
atgatcatcgcacttggtggtggttcaccgatggatgctgcgaaaggcatgtggctcttc
tacgaacgtccagaagagaagttctcgaatctacgccagaaatttatggatattcgcaaa
cggacgtataagttcccgacactcggtaacaagtcaatgtttatcgccatcccgacaacg
tcaggtacaggttctgaagtgacaccgttcactgtcatcacagataaaaaacgtaacgtg
aaatatccgattgctgactatgcgatcacaccagacgtcgccatcgtcgaccctgagttc
gtcatgaccgtcccagcttcaatcacggctgatacaggaatggacgtcatgacacacgca
atcgaagcatatgtttccgtcatggcgaatgattacacagacggactttgcctccgcgcc
atcaagatgatcttcgactacctaccaaaagcgtatgaaaacggtagcgatgcggaagct
cgtcagaaagtacacaacgcttcaacgatggcgggtatggcgtttgcgaacgcgttcctc
ggaatcaaccactcgatcgctcacaaaatcggtggagagttccacgtcccacacggtcgt
acgaacgcgattctcatgccacacgtcatccgttacaacgcgacacgcccatcgaaactt
gcggcgttcccgaaatatgagtcattcatcgctgacgaacgttacgcagaaatcgcgcgt
tacctcggacttccagcaagcacgacagctgaaggtgtcgagtcactcgtccaagcgatc
atcgagctcggtcaacgcttgaacatcaaactttcgttcaaggcgcaaggtatcaagaaa
gcagaacttgatgcgaagatcgacaagatggcggtcgacgcattcgaagaccaatgtacg
acggccaacccgaaaatgccgctcgttgaagaattaaaagaaatcatgtacgcagcatac
gaaggcgtataa

DBGET integrated database retrieval system