KEGG   Exiguobacterium sp. AT1b: EAT1b_0550Help
Entry
EAT1b_0550        CDS       T00897                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00010  Glycolysis / Gluconeogenesis
eat00052  Galactose metabolism
eat00500  Starch and sucrose metabolism
eat00520  Amino sugar and nucleotide sugar metabolism
eat00521  Streptomycin biosynthesis
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01120  Microbial metabolism in diverse environments
eat01130  Biosynthesis of antibiotics
eat01200  Carbon metabolism
Module
eat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eat_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0550
   00052 Galactose metabolism
    EAT1b_0550
   00500 Starch and sucrose metabolism
    EAT1b_0550
   00520 Amino sugar and nucleotide sugar metabolism
    EAT1b_0550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EAT1b_0550
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EAT1b_0550
Enzymes [BR:eat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EAT1b_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Acetate_kinase FtsA Cerato-platanin FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACQ69482
UniProt: C4L3I4
Position
complement(498168..499130)
Genome map
AA seq 320 aa AA seqDB search
MKWLLGIDIGGTTVKMAVLDMNGIISDKWEVKTDIRENGVHIPKDIAASFETYLQTSGKK
KEDFAGAGIGAPGFVNFSEGVVEYSPNIGWKDFALVSEFEKAVGLPAVLENDANAAALGE
MWKGAGEGASELLAITLGTGVGGGVITNGNIVHGTAGMAGEIGHITVERDETKAVKCGCG
RLGCIETIASATGISRLALQKRKNQDTSLNELKEVTARDVFEAYKAGDSIATEVIEEMTE
YLGLTISNIANTLNPKMIVIGGGVSKAGDALLEPLDAQFKRFALERVYESTTFKIAELEN
DAGVIGCAWLARKHFLPTRV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttattaggtatcgacatcggtggtacgacggtgaagatggccgttttagac
atgaacggcatcatttcggataagtgggaagtcaaaacggatattcgagagaatggtgta
catattccaaaagacatcgcagcttcttttgaaacatacttacaaacatcaggtaagaag
aaagaagattttgcgggtgcgggaatcggggcaccaggattcgtcaacttctcagaagga
gttgtcgaatattctccgaacatcgggtggaaagattttgctctcgtgagtgagttcgaa
aaagcagtcggtcttccggccgtgctcgaaaatgatgcgaacgccgcggcccttggtgag
atgtggaaaggtgccggcgaaggggcatcagaattattggcgatcacgctcggtacaggt
gtcggtggtggcgtgatcacgaacggaaatatcgttcatgggacggcaggaatggccgga
gaaatcgggcatattaccgtggaacgagacgaaacgaaagctgtgaagtgtggttgtggt
cgcctcgggtgtattgagacgattgcttcagcgaccggcatctcgcgtttggcgttacag
aagcgtaaaaatcaagatacttcattaaacgagttaaaagaagtgactgcacgtgacgtg
tttgaagcatataaggctggtgactcgatcgcgacagaagtcattgaagagatgacggaa
tacctcggcttgaccatctcaaacatcgcgaacacgctcaatccgaaaatgattgtcatc
ggtggaggtgtctcaaaagctggtgacgcgttattggagccgcttgatgcacagttcaaa
cggtttgcgctcgagcgggtatacgagtcgacaacattcaaaatcgctgaactcgaaaac
gatgccggtgtgattggatgtgcttggctggcacggaaacacttccttccgacacgagta
tga

DBGET integrated database retrieval system