KEGG   Exiguobacterium sp. AT1b: EAT1b_0858Help
Entry
EAT1b_0858        CDS       T00897                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00040  Pentose and glucuronate interconversions
eat00052  Galactose metabolism
eat00500  Starch and sucrose metabolism
eat00520  Amino sugar and nucleotide sugar metabolism
eat01100  Metabolic pathways
eat01130  Biosynthesis of antibiotics
Module
eat_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAT1b_0858
   00052 Galactose metabolism
    EAT1b_0858
   00500 Starch and sucrose metabolism
    EAT1b_0858
   00520 Amino sugar and nucleotide sugar metabolism
    EAT1b_0858
Enzymes [BR:eat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAT1b_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3 Exo70
Motif
Other DBs
NCBI-ProteinID: ACQ69787
UniProt: C4L5H2
Position
complement(810843..811724)
Genome map
AA seq 293 aa AA seqDB search
MTRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVNKPTIQFIVEEAVASGIEDIIIVTGKN
KRAIEDHFDRALELEQNLESKGKTRLLESVRHSSNLANIHYIRQQEPKGLGHAIWCARKF
IGDEPFAVLLGDDIIESDVPATKQLIDQYEAHERSIIGVQRVPYEMTNRYGIIDPLAVEG
KLIPVRTFVEKPPVDEAPSNFAILGRYILKPDVFEALSGQEAGAGGEIQLTDAIARLNEA
QTVFAYEFDGRRYDVGEPIGFVETTICHALSDPDLKDDVHALLKRLVDELDQQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacacgagtacgaaaagccatcattccagccgccggtctcggcacccgcttccttcct
gccacgaaagccatgccgaaagaaatgttgccgatcgtcaacaagccgaccatccagttc
atcgtcgaggaggccgttgcttcaggcatcgaggacatcatcatcgtcacgggaaagaac
aagcgggcgattgaagaccatttcgaccgtgcactcgaattagagcagaaccttgaatcg
aaagggaagacgcgcttgctcgaatcggtccgacattcctcgaacttggcgaacattcac
tacatacgccaacaggagccaaaaggtcttggtcatgcgatctggtgcgcccggaagttt
atcggggatgagccgttcgccgtcttgctcggggacgatatcatcgaatccgacgtgccg
gcgacgaagcagttgatcgaccaatatgaggcgcacgaacgttcaatcatcggggtgcag
cgtgtcccgtatgaaatgacgaaccgatatggtataattgacccgcttgccgtcgaaggg
aagctcatcccggtgcgaacgttcgtcgagaaaccgcccgtcgatgaggccccgtcgaac
ttcgccatcctcggtcgctacatcttgaaaccggacgtctttgaggcgttatcggggcaa
gaggctggagctgggggcgagattcaattgacggatgcgatcgcacgcttgaatgaggcg
cagacggtcttcgcctacgaatttgacggtcgacgttacgacgtcggagagccgatcggg
ttcgtcgagacgacgatttgccacgcgctcagcgatcctgatttaaaagatgacgtccat
gccctattgaagcggctcgtggacgaacttgatcaacagtaa

DBGET integrated database retrieval system