KEGG   Exiguobacterium sp. AT1b: EAT1b_1382Help
Entry
EAT1b_1382        CDS       T00897                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00330  Arginine and proline metabolism
eat01100  Metabolic pathways
Module
eat_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EAT1b_1382
Enzymes [BR:eat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     EAT1b_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACQ70309
UniProt: C4KYZ6
Position
complement(1353261..1354142)
Genome map
AA seq 293 aa AA seqDB search
MIKRFDEAYSGKVFIASLPEVTEAKTVLYGMPMDWTVSFRPGSRFGPNRIREVSIGLEEY
SPYLDGDLADAAVYDAGDIPLPFGNAPKSLDMIEAFVKDVVKAGKFPLGMGGEHLVTWPI
IKAMHDVYGNDFVILHLDAHTDLRDEYEGEPLSHSTPLKKAANLIGPSNCYSFGIRSGMK
EEFEWAREVGYNMHQFEVIEPLKRVLPTLAGKKVYVTIDIDVLDPSAAPGTGTQEIGGIS
TKELLEAVHAIANADLDIIGADLVEVSPAYDQSDMTAIAAAKILREMMIGFVK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgtttcgatgaagcctactcaggtaaagtgtttatcgccagcctcccagag
gtgacagaggcgaagacggttctttacgggatgccgatggactggacagtcagcttccgt
ccaggttcgcgtttcggtccgaaccggattcgtgaagtatcgattggactcgaggaatac
agcccgtatttagacggtgacttggctgatgccgcggtgtacgatgcaggcgatatcccg
cttccattcgggaacgcaccgaagtcgctcgatatgatcgaggcgttcgtcaaagatgtc
gtcaaagcaggtaagttcccactcggcatgggtggcgaacaccttgtcacatggccgatc
atcaaagcgatgcacgacgtgtacggcaacgactttgttatcctccacttggatgcgcac
acggaccttcgagatgagtatgaaggcgagccgctctcacactcgactccgctcaaaaaa
gcggcaaacttgatcggaccatcgaactgctattcgttcggaatccgttcagggatgaaa
gaagagtttgagtgggctcgtgaagtcggctacaacatgcatcaatttgaagtgatcgaa
ccactcaagcgtgtcttaccgacactcgctggtaaaaaagtatacgtcaccatcgacatc
gacgtcctcgacccgtcagcggcaccagggacagggacgcaagaaatcggtggcatctca
acgaaagaattgctcgaagcggtacatgccattgcaaacgcagacctcgacatcatcggt
gcagaccttgtcgaagtgtcaccggcatacgatcagtcagatatgactgccatcgcagca
gctaagattcttcgtgagatgatgattggattcgtgaagtaa

DBGET integrated database retrieval system