KEGG   Exiguobacterium sp. AT1b: EAT1b_1437
Entry
EAT1b_1437        CDS       T00897                                 

Definition
(GenBank) 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00270  Cysteine and methionine metabolism
eat01100  Metabolic pathways
Module
eat_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:eat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EAT1b_1437
Enzymes [BR:eat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     EAT1b_1437
SSDB
Motif
Pfam: HAD Put_Phosphatase HAD_2 UMPH-1 Hydrolase Hydrolase_like
Other DBs
NCBI-ProteinID: ACQ70364
UniProt: C4KZ51
Position
1405777..1406427
AA seq 216 aa
MSTHVICDFDGTITEEDNIIALMRRFAPPEWVELKDSVLNQTLSIREGVGQMFSLLPSNQ
QERYREFLQSTITLRAGFVEFLQETQSHGFRFDVVSGGMDFFVHPILEGHVAPEHIFCNH
VDFSGETARVTWPHACDVHCLNDCGCCKPTIARQIVSPTDTLIVIGDSVTDFEIAKRADV
VYARGQLISLCEAEGIRHVPFETFYDISAYMKGVNV
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagtacgcacgtcatctgtgatttcgacgggaccatcacggaagaagataacatcatc
gcgttgatgcgacggttcgccccacctgaatgggtcgaacttaaagatagtgtgttgaac
caaacgctctccattcgcgaaggcgtcggtcagatgttcagcttgctcccaagtaaccag
caagagcggtatcgtgagtttcttcagtcgaccatcacgcttcgagcggggtttgtcgag
tttttgcaagagactcagtcgcacggctttcgatttgatgtcgtcagtgggggcatggac
tttttcgtccatccgattttagaaggtcacgtcgcaccggaacacatcttctgcaatcac
gttgatttttcaggagagacagcgcgcgtcacatggcctcatgcatgcgatgttcattgt
ttgaatgattgcggatgctgcaagccgacgattgctcgacagattgtctcacctaccgac
acgttgattgtcatcggggactctgtcactgattttgaaatcgccaaacgtgccgatgtc
gtgtatgcacgaggtcaactgatttcgctttgtgaggcggaaggaattcgacatgttccg
ttcgagacattctatgacatttcagcttacatgaaaggagtgaacgtatga

DBGET integrated database retrieval system