KEGG   Exiguobacterium sp. AT1b: EAT1b_1697Help
Entry
EAT1b_1697        CDS       T00897                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00450  Selenocompound metabolism
eat00970  Aminoacyl-tRNA biosynthesis
eat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EAT1b_1697
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EAT1b_1697
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eat01007]
    EAT1b_1697
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eat03016]
    EAT1b_1697
Enzymes [BR:eat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EAT1b_1697
Amino acid related enzymes [BR:eat01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EAT1b_1697
Transfer RNA biogenesis [BR:eat03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EAT1b_1697
 Prokaryotic type
   Other AARSs
    EAT1b_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACQ70623
UniProt: C4KZW0
Position
complement(1647536..1649497)
Genome map
AA seq 653 aa AA seqDB search
MAKPTFYITTPIYYPSAKLHIGHAYTTVAGDAIARYKRLKGFDVRYLTGTDEHGQKIQEK
AKEAGVTPQAFVDEVVEEIKVLWDRLEISYDDYIRTTEDRHKKVVEHVFETLLKNGDIYL
GEYEGWYSVPDETYYTESQLVDGKSPDSGHPVELVREECYFFRLSKYADRLIEYFESHPD
FILPESRKTEMINNFLKPGLQDLAVSRTTFDWGVQVPSNPKHVVYVWVDALTNYISSLGY
GTDNDELFNRYWPADVHLVGKEIVRFHTIIWPALLMALDLPLPKQVFAHGWLLMKDGKMS
KSKGNVVDPIPLIDRYGLDSVRYYLLREVPFGADGTFTPEAFVDRLNFDLANDLGNLLNR
TIAMIKKYFDGNIPAYNGNVTAFDAELLNVVKETTRKTEEAMEHMEFSVALTNIWQLVSR
ANKYIDETQPWVLVKEESKREELASVMTHLAGVLRHVAIMIQPFMTRAPKEMFRQLGLEG
EDMSWEALDTFADFSDAVVTDGTPIFPRRDVKEEVDAIQEMMRQASKARIEETETASVEE
ADEDIRPEITIDVFDQVEFRVGQIVEADKIKKAKKLLKLQVDLGKETRQIVSGIAEWYAP
EDLVGKKVIVVANLKPVKLRGELSQGMILAADRDGKLELATVSDQMPNGAIVK
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccgactttttatattacaaccccaatttattatccgagtgcaaaactgcat
atcggtcacgcatataccacggtagcaggtgatgcgattgcgcgctacaaacgcttaaaa
ggatttgatgtccgttatttgaccggaacggatgagcacggtcaaaagattcaagaaaaa
gcgaaagaagcaggcgtgacgccacaagctttcgtggatgaagtcgtggaagagatcaag
gtcttatgggaccgtctcgaaatctcgtacgatgactacatccgtacgacagaggaccgc
cataagaaagtggtcgagcatgttttcgagacattacttaaaaatggggacatctacctc
ggtgagtatgaaggatggtattccgtaccggatgagacgtactacactgaatcgcagctc
gtcgacggaaaaagtcctgacagtggacatccggtcgaactcgttcgtgaggagtgctac
ttcttccgcctcagtaaatacgcggaccgcttgattgaatattttgagtcacatcctgat
tttattttgccagaatctcgtaaaaccgagatgatcaataacttcttaaagccgggtctt
caagatttggctgtatcacgtacgacatttgactggggcgtacaagtcccatcgaacccg
aagcacgtcgtgtacgtatgggtcgatgcgctcacaaactatatctcatcactcggatac
ggtacagacaacgatgaactcttcaaccgttactggccagcagacgttcatttggtaggg
aaagaaatcgtccgtttccatacgatcatttggccagccctcttaatggcgcttgatctt
ccattaccgaagcaagtatttgcgcacggatggttgctcatgaaggatgggaaaatgtcg
aaatcgaaagggaacgtcgtggacccaatcccattgatcgaccgttacggcctcgactcg
gtccgctattatcttctccgtgaagttccattcggagcggatggcacgttcacgccggaa
gcgttcgttgaccgcttgaactttgatttagcgaacgacctcggaaacttattgaatcgc
accattgcgatgattaaaaagtacttcgatggaaacattccggcatataacggaaatgtc
acggcatttgatgcagaattgttgaacgtggtgaaagagacgacacgcaaaacagaagaa
gccatggagcacatggagttttcggtcgcgctcacaaacatttggcaactcgtcagccgt
gcgaataaatatatcgatgagacacaaccatgggttctcgtgaaagaggagtcgaagcgc
gaggagctggcttctgtcatgacacaccttgcgggcgtacttcgtcatgttgccatcatg
attcaaccattcatgacgcgcgctccaaaagagatgttccgtcagctcggactcgaggga
gaggacatgtcatgggaggcgttggatacattcgcagactttagtgacgcagttgtgacg
gacgggacaccgattttcccacgtcgtgacgtgaaagaagaagtcgatgcaatccaagaa
atgatgcgtcaggcgtctaaagcacggattgaagagacggagacggcatcagtagaagaa
gctgacgaagacattcgtcctgaaatcacgattgatgtcttcgatcaagtcgaattccgt
gtcggtcaaatcgtcgaagccgataagattaaaaaagcgaagaaactgttgaaacttcaa
gtcgaccttgggaaagagacgcgtcaaatcgtgtctggtatcgctgaatggtatgcccct
gaagatttggttggcaagaaagtcatcgttgtcgcaaacttgaaaccagtcaagctccgt
ggagaactctcgcaagggatgattctagctgcagatcgtgacgggaaactagagctcgcg
acggtctcagaccagatgccgaacggtgccatcgtcaaataa

DBGET integrated database retrieval system