KEGG   Exiguobacterium sp. AT1b: EAT1b_1879Help
Entry
EAT1b_1879        CDS       T00897                                 

Definition
(GenBank) glycoside hydrolase family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00010  Glycolysis / Gluconeogenesis
eat00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_1879
   00500 Starch and sucrose metabolism
    EAT1b_1879
Enzymes [BR:eat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EAT1b_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4106
Motif
Other DBs
NCBI-ProteinID: ACQ70805
UniProt: C4L0E2
Position
1846345..1847790
Genome map
AA seq 481 aa AA seqDB search
MKQVSSDFLWGGATAANQLEGGYQEGGKGLSIADVMPGGKQRMKIIHDPAFDFELHDEYS
YPNHEGIDFYHRYKEDIALFKEMGFKTFRMSIAWSRIFPNGDEVEPNEEGLQFYDRVINE
LVAQGIEPLVTISHYEMPLHLAKHYGGWRDRRLVTYFERYSRVLFERYKGKVKYWLTFNE
INGAQFMPMLSLGIAVREEENTLQLTYQGLHHQLVASALATKAAREIDPSMQIGCMLIAA
PVYPYSSNPDDVWYAHDAERMMNFFCGDVHVRGKYPSFAKRFFQENGIELEMEDGDLEIL
KENTVDFFSLSYYMSRTEKAEKDQNEAEGNIMSGVKNPYLQASDWGWEIDPTGLRVILNK
LYERYELPLFIVENGLGAYDQVESDGTIHDHYRIDYLRDHLKGMIDAIEDGVEVMGYTSW
GCIDLVSASTGEYSKRYGFIYVDRHDDGTGTLERKRKESFFWYQEVIRSQGASLYEEESV
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtatcaagtgattttctatggggcggggccactgcggccaatcaactagag
ggcggttatcaggaaggcggtaaaggactttcgattgcagacgtgatgccaggtgggaaa
cagcgaatgaaaatcattcatgacccagcgtttgattttgagttacatgatgaatattca
tatccgaaccatgaaggaattgacttctatcatcgttacaaagaagatatcgcccttttt
aaggaaatgggattcaagacgttccgtatgtcgattgcctggtcacgaattttcccgaac
ggcgatgaagtggaaccgaatgaggagggactccaattctatgatcgtgtcatcaatgag
ttggtcgcccaaggcattgaaccactcgtgacgatttctcattatgagatgcccttacat
cttgcgaagcattatggagggtggcgagaccgtcgcttagtcacctatttcgaacgatac
agccgcgtcttgttcgaacgttataaagggaaggtcaaatattggttgacgttcaatgag
atcaacggagcgcagttcatgccgatgctcagtctcggaatcgcagttcgagaagaagag
aacacattacaacttacgtatcaaggacttcatcaccaactggtcgcaagtgcactcgcg
acgaaagcggcccgcgagattgacccatcgatgcaaatcggatgtatgctgattgcagct
ccggtttatccatacagctcaaacccggacgatgtttggtatgcccacgatgctgagcgg
atgatgaacttcttctgtggagatgttcacgtacgcgggaaatacccaagctttgcaaaa
cgctttttccaagagaacggcattgaacttgaaatggaagatggcgaccttgaaatccta
aaagaaaatacagttgatttcttttcgctcagttattatatgtcgcgcactgaaaaggct
gaaaaagaccagaatgaagcggaaggtaatatcatgagtggggtcaaaaatccatactta
caagcgagcgactggggatgggagattgacccgaccggacttcgtgtcatcttaaacaaa
ttatatgagcgttatgagcttccattattcatcgttgagaatggattaggtgcatatgat
caagtcgagtcggacggaacgattcatgatcactatcggattgattacttacgtgatcat
ttgaaagggatgatagacgcaatcgaagatggtgtcgaagtgatggggtacacgagttgg
ggctgtatcgatttagtgagtgcttcgacaggcgagtacagcaaacggtatggtttcatt
tatgtggatcgacatgacgacggtaccggtacgttagaacgaaaacggaaagaatcattc
ttctggtatcaagaggtgattcgttcgcaaggcgcgagcttatatgaagaggaatcagtc
aaatga

DBGET integrated database retrieval system