KEGG   Exiguobacterium sp. AT1b: EAT1b_1955Help
Entry
EAT1b_1955        CDS       T00897                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00030  Pentose phosphate pathway
eat01100  Metabolic pathways
eat01120  Microbial metabolism in diverse environments
eat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EAT1b_1955
Enzymes [BR:eat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     EAT1b_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DAHP_snth_FXD
Motif
Other DBs
NCBI-ProteinID: ACQ70879
UniProt: C4L0L6
Position
1915277..1916074
Genome map
AA seq 265 aa AA seqDB search
MANYPELKGKVAVITGSSKGLGRAIGERYAKEGMSVVLNYRSSEKEMEEVIRGIEAAGGK
AVAVKGDVAEEGLAEKMIEKAISEFGKMDIFVNNAGVQVEAKTHEMEFDNWKQIIDVNLN
GTFLGVRAALKYFVEHEIEGNIINMSSVHEVIPRPGYTHYAASKGGVKMFTKSVALEYAP
NHIRVNAIAPGAIDTPINEETMSDPEEKKGLEALIPSHVIGKPEQIAAVAAWLASDESSY
VTGTTIFADGGLSLYPSFGPENKVQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcaaactatccagagttaaaaggtaaggtcgcggtcatcacgggcagctcgaagggg
ctcggtcgtgccatcggggaacgttacgcaaaagaagggatgagcgttgtcctgaattac
cgcagcagtgaaaaagagatggaggaagtcatccgtggcatcgaggcagctggtgggaaa
gccgtcgccgtgaaaggggacgtcgcggaagaaggactcgcggagaagatgattgagaaa
gctatctctgagtttggaaagatggatattttcgtgaataacgccggcgttcaagtcgag
gcaaaaacgcatgagatggagtttgataactggaagcagattatcgatgtcaacttgaac
gggacgttccttggtgtccgtgctgctttaaaatacttcgtggagcatgaaatcgagggg
aacatcatcaatatgtcttctgttcacgaagtcatcccacgtccaggttatacacattac
gcagccagcaagggtggcgtgaaaatgttcacgaaatccgtcgcactcgaatatgcaccg
aaccatattcgtgtcaatgcgatcgcacctggggcaatcgatacaccaatcaacgaagag
acgatgagcgacccggaagagaagaagggattagaagcgctcatcccatctcacgtcatc
gggaagccggaacaaatcgcagccgttgccgcttggctcgcgtcggatgagtcgtcctat
gtaacggggacaaccatctttgcggacggtgggctttcgctctatccgtcatttggtcca
gagaacaaagtccaataa

DBGET integrated database retrieval system