KEGG   Exiguobacterium sp. AT1b: EAT1b_2787Help
Entry
EAT1b_2787        CDS       T00897                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00010  Glycolysis / Gluconeogenesis
eat00020  Citrate cycle (TCA cycle)
eat00620  Pyruvate metabolism
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01120  Microbial metabolism in diverse environments
eat01130  Biosynthesis of antibiotics
eat01200  Carbon metabolism
Module
eat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_2787
   00020 Citrate cycle (TCA cycle)
    EAT1b_2787
   00620 Pyruvate metabolism
    EAT1b_2787
Enzymes [BR:eat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EAT1b_2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACQ71701
UniProt: C4L5B6
Position
2754538..2755827
Genome map
AA seq 429 aa AA seqDB search
MAVFEFKLPDIGEGIHEGEIVKWFVKAGDTVKEDDVLLEVQNDKAVVEIPAPVDGTVKEV
KVSEGTVAVVGDVLITFDIEGDAPAGEEETPEQPKAEEKTEDVKEDVKEDAPRDVQLHKS
ERVIAMPSVRKYAREKGVDIREVNGSGDNGRVLKEDIDAFANGEAPSAEATTEKTESVAP
AAAAKTEIKPYESATPELETREKIRGIRKAISKAMVNSKHTAPHVTLMDEVDVTKLVALR
KDFKQVAADQGVKLTYLPFVVKALTAAAKAFPTINASIDDVNEEIVYKNYYNIGIAADTD
NGLVVPVVKDADRKSIYALATNINELAGKAREGKLAGEDMKGGSITITNIGSAGGQWFTP
VINHPEVAILGIGRIAEKAVVKNGEIVAAPVLALSFSFDHRLIDGATAQNALNMVKRLLE
DPALLMMEG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtatttgaatttaaattaccagatatcggtgaaggtattcacgaaggtgaaatc
gtcaagtggttcgtaaaagcaggggatacggtcaaagaggacgatgttcttttagaagta
caaaacgacaaagcagtcgttgaaatcccagctccagttgacggtacagtcaaagaagtt
aaagtttctgaaggtacagttgccgtagtcggcgacgtcctcattacgtttgacatcgaa
ggcgacgcaccagcaggtgaagaagaaacacctgaacaaccgaaagcagaagagaagaca
gaagacgtaaaagaagatgtgaaagaagacgcgccacgcgacgttcaacttcacaaatct
gaacgtgttatcgctatgccatctgtccgtaaatatgcacgtgaaaaaggtgtcgacatc
cgtgaagtcaacggttctggcgacaacggccgtgtattgaaagaagacatcgatgcattc
gcgaacggcgaagcaccgtctgcagaagctacaacagagaaaacagaatctgtagcacca
gcagcagctgcgaaaacggaaatcaagccttacgagtcagcgactcctgaacttgaaaca
cgtgagaaaatccgtggaatccgtaaagcgatctcgaaagcgatggttaactcgaaacac
actgcaccacacgttacactcatggacgaagtcgacgttacaaaactcgttgcactccgc
aaagacttcaaacaagtcgcggctgaccaaggcgtgaaactcacgtacttgccattcgtc
gtgaaagcattgactgctgcagcgaaagcattcccaacaatcaacgcttcaatcgatgac
gtgaacgaagaaatcgtctacaaaaactactacaacatcggaattgcagctgacacggac
aacggactcgttgtaccagtcgtaaaagatgcagaccgtaaatcaatctatgcacttgct
acaaacattaacgaacttgcaggtaaagctcgtgaaggtaagctcgctggggaagacatg
aaaggcggatcgatcacaatcacaaacatcggttcagctggtggacaatggttcacacct
gtcatcaaccacccagaagttgcgattctcggtatcggccgcatcgctgagaaagctgtc
gtgaagaacggtgaaatcgttgctgcgccagtacttgcactttcattcagctttgaccac
cgcctcatcgacggtgcgactgcacaaaacgctcttaacatggtgaaacgcttgctcgaa
gacccagcacttctaatgatggagggataa

DBGET integrated database retrieval system