KEGG   Exiguobacterium sp. AT1b: EAT1b_2948Help
Entry
EAT1b_2948        CDS       T00897                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00900  Terpenoid backbone biosynthesis
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAT1b_2948
Enzymes [BR:eat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     EAT1b_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACQ71862
UniProt: C4L656
Position
2904984..2906141
Genome map
AA seq 385 aa AA seqDB search
MKRISLIGGTGSIGVQTCDVIEQHPDLFELEAYAFGTNVEVATEWINRLRPKYVSATSIE
VLEQLKPRLTYEPLYFIGPEGLKECATAERADIVVTAVVGAVGLEPTLAAIQAGKDIALA
NKETLVTAGHLVKAAVKEHGVNLLPVDSEHSAIYQCLNGERREDVSKIILTASGGSFRDR
SRDELADVTVEDALNHPNWSMGAKITIDSATMFNKGLEVIEAHWLFDIDYNDIEVILHRE
SIIHSMVEFKDAAVMAQLGNPDMRGPILYALSGPKRLEIEGNKRLNLKEIGKLHFEEADF
NRYPALRLAFEAGRAGGSMPTVLNAANEVAVDLFLNGQITFLEIERLVEDAMARHEVIAE
PTLAQILEVDRAVRQQIQQGIEGGE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaattagcttaattggggggactggttcgattggcgttcaaacttgtgacgtc
atcgaacagcaccctgacctgtttgaacttgaggcgtatgcgttcggaacgaacgtcgag
gtcgccacggaatggatcaatcgacttagaccaaaatatgtgtcggcaacgagtatcgaa
gtactcgaacagttgaagccgcgtcttacatatgaacctctctattttattggaccggag
gggctgaaggagtgtgcgacggcagaacgggctgacatcgtcgtgacggcagtcgttgga
gcagttggacttgaaccgacgcttgcggcgattcaagcagggaaagatattgcactcgcc
aacaaggaaacactcgttaccgcaggacatcttgtcaaagcggccgtgaaagaacatggg
gtcaacctgttgcctgtcgacagtgaacactccgcgatctatcaatgtttgaacggggaa
cgaagagaagatgtatccaagattattctaacggcttcaggcggtagtttccgtgatcgt
tcacgcgatgagctggctgatgtgactgttgaagacgcactgaatcatccgaactggtca
atgggagcaaaaatcaccatcgattcggcgacgatgttcaacaaaggccttgaagtcatc
gaggcacactggctgttcgatatcgattataatgatattgaagtcatcttacatcgtgaa
tcgattattcattcgatggtcgaatttaaagatgctgccgtgatggcccagctcggaaac
ccggatatgcgtggtccgatcctttatgcgctatcgggaccgaagcggcttgaaatcgag
gggaataagcggttaaacttgaaggaaatcggaaagctgcattttgaagaggctgatttc
aatcgctacccggcactccggttagcgttcgaagcaggaagagccggtggttctatgccg
accgtcctgaatgcagccaatgaagtggcagtagacctattcttgaacggtcagattacg
tttttagagattgaacgactcgtcgaagatgcgatggctcgacatgaggtcatcgccgag
ccgacgctcgcgcaaattctagaagttgaccgagcagtacgtcaacagattcagcaagga
attgaaggtggggaataa

DBGET integrated database retrieval system