KEGG   Enterobacter asburiae L1: DI57_01105Help
Entry
DI57_01105        CDS       T03084                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eau  Enterobacter asburiae L1
Pathway
eau00071  Fatty acid degradation
eau00072  Synthesis and degradation of ketone bodies
eau00280  Valine, leucine and isoleucine degradation
eau00310  Lysine degradation
eau00362  Benzoate degradation
eau00380  Tryptophan metabolism
eau00620  Pyruvate metabolism
eau00630  Glyoxylate and dicarboxylate metabolism
eau00640  Propanoate metabolism
eau00650  Butanoate metabolism
eau00900  Terpenoid backbone biosynthesis
eau01100  Metabolic pathways
eau01110  Biosynthesis of secondary metabolites
eau01120  Microbial metabolism in diverse environments
eau01130  Biosynthesis of antibiotics
eau01200  Carbon metabolism
eau01212  Fatty acid metabolism
eau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DI57_01105
   00630 Glyoxylate and dicarboxylate metabolism
    DI57_01105
   00640 Propanoate metabolism
    DI57_01105
   00650 Butanoate metabolism
    DI57_01105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DI57_01105
   00072 Synthesis and degradation of ketone bodies
    DI57_01105
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DI57_01105
   00310 Lysine degradation
    DI57_01105
   00380 Tryptophan metabolism
    DI57_01105
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DI57_01105
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DI57_01105
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DI57_01105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eau04147]
    DI57_01105
Enzymes [BR:eau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DI57_01105
Exosome [BR:eau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DI57_01105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHW92999
Position
208016..209194
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVKALVERSGIAAHEVDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVIIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISREVQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQSGERILVDTDEQPRTDASAEGLARLNPAFEMQG
SVTAGNASSINDGAAAVMMMSESKALELDLPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWQLSDVDLIEVNEAYAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtaatagtgggtgcgttgcgtacagctatcggctgttttcagggagcg
ctcgcgcgtcactcggcggttgacctgggcagcgtggtggtaaaagcgctggtggaacgc
agcgggatcgcagcacatgaagttgatgaggtgatcctgggacaggtcctcacggccggt
gccgggcaaaaccctgcgcgtcaggcggcgctgaagggcgggctgcccaataccgtttcc
gccatcaccatcaacgacgtctgtggttcaggattaaaagcgctgcatctcgctacgcag
gccattcagtgtggtgaagcggacgtgatcatcgcgggcgggcaggagaatatgagccgc
gcgccgcacgtgttgaccgacagccgaaccggcgcacagctgggcaacagccagctgctc
gacagcctggtgcatgacgggctgtgggatgcgttcaatgactatcatatgggcgtgacg
gcggaaaacctggcgcgcgagtacggcatcagccgtgaggtgcaggatgcctacgcgcta
agctcgcagcaaaaagcgcgtgctgcgattgattccggtcgttttcgcgacgagattgtc
ccggtcagcacgcagcgtcagagcggcgagcgtatcctcgtggataccgatgaacagccg
cgcaccgacgccagcgctgaaggcctggcgaggctgaaccccgcgtttgaaatgcagggc
tcggtgacggcgggaaatgcctcttccattaacgacggcgctgccgccgtcatgatgatg
agcgaaagcaaagcccttgaactcgatcttcccgtcctggcccgcattaaagcattcgcc
agcgtgggggttgatcctgcgttaatggggatcgcaccggtctacgctacccgccgctgc
ctggagcgcgcggggtggcagctttcggatgtggatctgatcgaagtgaacgaagcctat
gccgcgcaggcgatctccgtcgggaaaatgctggagtgggatcccctgcgggtcaacgtt
aacggcggcgcgatcgcgctggggcatcctatcggtgcgtccggctgccggatcctggtt
tcgctggtccacgaaatgaaaaagcgcaatgcccgcaaagggattgccacactctgtata
ggcggcgggcaaggggtggcgctggccatcgaacgctaa

DBGET integrated database retrieval system