KEGG   Enterobacter asburiae L1: DI57_01235Help
Entry
DI57_01235        CDS       T03084                                 

Gene name
recB
Definition
(GenBank) exonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
eau  Enterobacter asburiae L1
Pathway
eau03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eau00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DI57_01235 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eau03400]
    DI57_01235 (recB)
Enzymes [BR:eau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DI57_01235 (recB)
DNA repair and recombination proteins [BR:eau03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DI57_01235 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_11
Motif
Other DBs
NCBI-ProteinID: AHW93025
Position
239845..243387
Genome map
AA seq 1180 aa AA seqDB search
MTDTAESLDPLRLPLQGERLIEASAGTGKTFTIAALYLRLLLGLGGNAAFPRPLSVEELL
VVTFTEAATAELRGRIRSNIHELRIACLRQSTDNPLYASLLEEIADKQQAAQWLLLAERQ
MDEASVFTIHGFCQRMLSLNAFESGMLFEQQLIEDESVLRYQACADFWRRHCYPLQRDIA
EAVHALWKGPEALLRAIDRYLQGEAPVIKSPPPADETLASRHEKIIARIADIKQKWIESV
GEIDAIIENSGIDRRKFNRGNQGKWIDKISAWAQEETRGYQLPDALEKFSRRFLVERTKA
DGIVPEHPLFVAIETLLAEPLTLNDLMITRAMTEIRDAVAREKRRRGELGFDDMLSRLDA
ALCSENGEALAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIWRQQPGTALLLIGDPKQAIY
AFRGADIFTYMKARSEVDAHYTLDTNWRSSPGMVESVNALFSRMDTAFMFREIPFQPVKF
AEKNASLRFEFNGETQPAMNFWLLDGEGYGVADYQNAMAQHCAAQIRDWLSAGAHGKALL
WKGDKPAPVKASDITVLVRSRQEAALIRDALTLLNIPSVYLSNRDSVFETLEAQEMLWLL
QAVLAPERESTLRSALASAMLGLNARDIDALNNDEAAWDAVVEEFVRYREKWQKRGVMAM
VRELMAQRHIAENMLATAGGERRLTDILHISELLQEAGTQLESEHALVRWLAQQIADPNS
NSSSQQMRLESDKHLVQIVTIHKSKGLEYPLVWLPFIANYRVQDQAFYHDRESFEAVLDL
SNAESSVELAEAERLAEDLRLLYVALTRSVWHCSLGVAPLFRRRGEKTGESDFHLSALGR
LIQHGEPKDAAGLRQCIESLCTEHVALHIPSQPDNSRWQMPELRDSQLHARQVVRTIADD
WRVTSYSGLQQHGQSIAQDLMPKLDVDAAGAGSVPAEPVLTPHQFPRGASPGTFLHSLFE
ELDFTQPVSEEWVLKMLQSGGYDAQWQPVLTDWIRAVLHAPLTTQGISLNQLTAKDKQVE
MEFYLPIASPLRAEALDALIREYDPLSAGCPPLNFRQVQGMLKGFIDLVFRHEGRYYLLD
YKSNWLGESSEAYTQDAMASAMQMHRYDLQYQLYTLALHRYLRHRMADYRYEDHFGGVIY
LFLRGVDANDPRSGVFSTRPAAELIEKMDNLFAASTEEVA
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccgctgagtcccttgatcccttacgtttacctctgcagggtgaacgattg
attgaagcctcagcgggaacgggaaaaaccttcaccattgccgccctctatctgcgtctg
ctgctggggcttggcggcaacgccgcttttccacgccctttgagcgtggaagagctgctg
gtggttaccttcaccgaggctgccaccgctgagctgcggggccgtattcgcagcaatatc
cacgagctgcgcatcgcctgtctgcgtcagagcacggataaccctctctacgcgagcctt
ctggaagagattgccgataagcaacaggcagcccagtggctgctcctcgctgaacggcag
atggatgaagcgtccgtcttcaccattcacggtttttgccagcgtatgctgagcctgaat
gcatttgaatccggaatgctgtttgaacagcagctcattgaagatgaatccgtgcttcgc
tatcaggcctgcgcggatttctggcgtcgccactgctacccgttacagcgcgatatcgcc
gaagcggtacatgcgctgtggaaggggccggaggcgctgctgcgcgctatcgatcgttat
ctgcagggtgaagcgccggtcataaaatccccgccgccagcggatgaaaccctggcctca
cggcatgaaaaaatcatcgcgagaattgccgacatcaagcaaaaatggattgagtccgtt
ggcgagattgacgcaatcatcgaaaattccgggattgaccgacgcaagtttaaccgtggc
aatcaggggaaatggatcgacaagatcagcgcctgggcgcaggaagagacgcgaggctac
cagctcccggacgcgctggagaaattctcccggcgtttcctggttgagcggaccaaagcc
gacggcattgtgcctgagcatcctctgtttgtggcgattgaaaccctgctggctgagcct
ttaacgctcaacgatctgatgattacccgcgccatgacggaaattcgcgacgccgtcgcg
cgtgagaaacgccgccggggtgaactggggtttgacgatatgctgagccgactcgatgcg
gcgctgtgcagtgaaaatggcgaagcgcttgccgccgcgattcgcacccgcttcccggtg
gcgatgattgacgaatttcaggataccgaccctcaacaataccgcattttccgtcgtatc
tggcgccagcagcccggtaccgcgctgttgttaatcggcgatccgaaacaggccatctac
gccttccgcggtgcggatattttcacctacatgaaagcccgcagcgaggttgacgcgcac
tatacgctcgacaccaactggcgctcctctcccggcatggtggaaagcgtcaacgcgctc
ttcagccgcatggatacggcgtttatgttccgggagatcccgtttcagccggtaaaattt
gccgagaaaaatgcctcgttgcgcttcgagttcaacggcgagacgcagcctgccatgaac
ttctggctgctggatggggaaggctatggcgttgccgactatcaaaatgcgatggcccag
cactgtgccgcgcaaatccgcgactggctcagtgcgggcgcgcacggtaaagcgctgctg
tggaagggggataaacctgcgccggtaaaggcatccgatatcacggtgctggttcgcagc
cgtcaggaagccgcgctcatccgcgatgccctgacgttactgaatatcccctccgtctat
ctctcaaaccgcgacagcgtctttgaaacgctggaagcgcaggagatgctatggctgctg
caggccgtgctggctccggagcgggaaagcacgctgcgtagcgcattagcgagcgcgatg
ctcgggctgaatgcgcgggatattgatgcgctcaacaatgacgaagccgcgtgggatgcc
gtggtagaagagtttgttcgctaccgcgaaaaatggcagaagcgtggcgtgatggcgatg
gtgcgtgagctcatggcgcagcgccacattgcggagaatatgctggcgacagcaggcggc
gagcgccgtttgaccgatattttacatatcagcgaactgctgcaggaagccggtacacag
ctggagagtgaacacgctctggtacgctggctggcgcagcagattgccgatccgaacagc
aattcgtccagccagcagatgcgccttgagagcgataaacatctggtgcagatcgtcacc
attcacaagtcgaaaggcctggaatatccgctggtctggctgccgtttatcgccaattat
cgcgtgcaggatcaggccttttaccacgatcgcgagtcttttgaggcggtgctcgatctc
agcaacgcggagtccagcgttgagctggccgaagccgagcgtctggcggaagacctgcgc
ctgctttacgtggcgctgacccgttcggtctggcactgcagcctgggcgttgcgcctctg
ttccgtcgccgtggcgaaaagaccggggagagcgattttcatctgagcgcgctggggcgg
cttattcagcacggtgaacccaaagacgcggcaggcctgcgccagtgcatcgaatcactt
tgcacagagcatgttgccctgcatattccgtcgcagcccgacaacagccgctggcagatg
ccggagctgcgtgactcacagctccatgcccgccaggtagtacgtaccattgccgacgac
tggcgcgtcaccagctactccggtttacagcagcacgggcagagtattgcgcaagatctg
atgccaaaactggacgtggatgccgcaggagccggtagcgtacccgctgagccggtgctc
acgccgcaccagtttccgcgcggcgcctcgccgggcacgtttttgcacagcctgtttgaa
gagctggattttacccagccggtatccgaagagtgggtgctgaagatgttacagagcggc
ggctacgacgcacagtggcagccggttctcaccgactggatccgcgctgtactgcacgcg
ccgctcacgacacaggggatctccctgaaccagttgactgccaaagataagcaggtggag
atggagttttatcttcccatcgccagcccgctcagggccgaggcgcttgatgcgctgatc
cgcgagtacgatccgttatccgccgggtgcccgccgctgaacttccgccaggtgcagggg
atgctcaaaggctttatcgacctggttttccgccacgaagggcgctactacctgctggac
tacaaatcgaactggttgggtgaaagcagcgaagcctacacccaggacgcgatggcctct
gccatgcaaatgcatcgctacgatctgcagtaccagctttacaccctggcgctgcaccgt
tacctgcgccatcgcatggccgattaccgctacgaagatcattttggcggcgtcatttac
cttttcctgcgcggagtggatgctaacgacccgcgttccggcgtctttagcacgcgtccg
gcagcggaactgattgaaaaaatggataacctgtttgctgcaagcacggaggaggtggca
tga

DBGET integrated database retrieval system