KEGG   Enterobacter asburiae L1: DI57_03690Help
Entry
DI57_03690        CDS       T03084                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
eau  Enterobacter asburiae L1
Pathway
eau00430  Taurine and hypotaurine metabolism
eau00620  Pyruvate metabolism
eau00640  Propanoate metabolism
eau00680  Methane metabolism
eau01100  Metabolic pathways
eau01120  Microbial metabolism in diverse environments
eau01200  Carbon metabolism
Module
eau_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:eau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DI57_03690
   00640 Propanoate metabolism
    DI57_03690
  09102 Energy metabolism
   00680 Methane metabolism
    DI57_03690
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DI57_03690
Enzymes [BR:eau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DI57_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AHW93486
Position
complement(753137..754339)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDALNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPNLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFYVTQEAAKVLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYAEKEDAK
RAMDVYCHRLAKYIGSYTALMEGRLDAVIFTGGIGENAAMVRELSLGKLGVLGFDVDHER
NLAARFGKSGFINKEGTRPALVIPTNEELVIAQDAHRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagctcctcactgaaattcgccatc
atcgatgcgctcaacggtgacgaatacctctctggtttggccgaatgtttccatctgcct
gaagcacgtatcaagtggaagatggacggcagcaaacaagaagcggctttaggtgcaggc
gccgctcacagtgaagcgctgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgctcagctgactgcgattggtcaccgtatcgtccacggcggcgaaaaatacacc
agctccgtcgtgatcgacgaatctgtgatccagggcatcaaggactctgcgtccttcgca
ccgctgcacaacccggctcacctgatcggtatcgctgaagcgctgaaatccttcccgaat
ctgaaagacaaaaacgtggccgtattcgacaccgcgttccatcagaccatgccggaagag
tcttacctctatgccctgccatacagcctgtacaaagaacacggcgtacgtcgctacggc
gcacacggcaccagccacttctatgtgactcaggaagccgcaaaagttctgaacaagccg
gttgaagaactgaacatcatcacctgccacctgggcaacggtggttctgtttccgctatc
cgcaacggtaaatgtgttgatacttctatgggtctgaccccgctggaaggtctggtgatg
ggtacccgttccggtgacatcgacccggcgatcatcttccacctgcacgacaccctgggc
atgagcgttgaccagatcaacaaaatgctgaccaaagagtctggcctgctgggtctgacc
gaagtcaccagcgactgccgttacgttgaagacaactacgcagagaaagaagacgctaaa
cgtgcaatggacgtttactgccaccgtctggcgaagtacatcggctcttacactgcgctg
atggaaggccgtctggacgcggttatcttcaccggtggtatcggtgagaacgcggcaatg
gttcgtgaactgtccctgggcaaactgggcgttctgggcttcgacgttgatcacgagcgt
aacctggctgcccgcttcggcaagtctggcttcatcaacaaagaaggcacccgccctgct
ctcgttatcccaactaacgaagaactggtcattgcgcaagacgcgcaccgcctgactgcc
tga

DBGET integrated database retrieval system