KEGG   Enterobacter asburiae L1: DI57_07430Help
Entry
DI57_07430        CDS       T03084                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eau  Enterobacter asburiae L1
Pathway
eau00052  Galactose metabolism
eau00500  Starch and sucrose metabolism
eau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DI57_07430
   00500 Starch and sucrose metabolism
    DI57_07430
Enzymes [BR:eau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     DI57_07430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: AHW94203
Position
1572073..1573479
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAILQAVMKGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCEHRFKCWGHWSSADLVHWRHEPLALMPAEEFDRNGCYSGSAVDNHGLLTLCYTGNVK
FDDGSRTAWQCLAVEQPDGTFKKLGPVLALPEGYTGHVRDPKVWQHDGEWYMVLGAQDVQ
KRGKVLLFKSADLHAWTSCGEIAGHGVNGLTDAGYMWECPDLFALDGTHILISCPQGLAR
EPHRYLNTYPATWTSGAFDYASAAFDHGDLHELDAGFEFYAPQTTLAEDGRRILIGWMGV
PDGEEMLQPTRAHGWMHQMTCPRELRYRDGRLWQTPARELAALREDEQRWQGRGSEAPDL
DATRLEFELSASQVNVDFGGALRLTVDEQGIRLERASLKTGETLTRYWQGNVTHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRACMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccttcccgctggcctgcgatcctgcaggccgttatgaaaggtcagccgcgg
gcgctggcggatagccactacccgcagtggcaccccgcgccggtgacggggctgatgaac
gatcccaacgggtttatctggtttgccggccgctaccacctgttctatcagtggaatccg
ctggactgcgagcatcggtttaaatgctgggggcactggagctctgcggacctggtgcac
tggcggcacgagccgctggcgctgatgcccgccgaagagtttgaccgtaacggctgctac
tccggtagcgccgtggacaatcacggtttactgaccctgtgctacaccggcaacgttaag
tttgatgacggcagccgcacggcctggcagtgcctcgccgtggaacagccggacgggacc
tttaagaagctggggccggtgctggcgctgccggaaggctataccggccacgtgcgcgac
ccgaaggtgtggcagcacgacggagagtggtacatggtgctcggcgcgcaggatgtgcaa
aagcggggcaaggtgctgctgtttaaatcagccgatttgcacgcctggacgtcctgcggg
gaaatcgccggtcacggggtcaacggcctgacggacgcgggttatatgtgggagtgtccg
gacctgttcgcgctcgacggaacgcacatcttgatcagctgtccgcaggggctggcgcgc
gagccgcatcgctatctcaacacctacccggcgacctggacgagcggggcgtttgactat
gcaagcgccgcattcgatcacggcgatctgcacgagctggacgcgggctttgagttttac
gctccgcaaacgacgctggcggaagacggtcgacgcattctgatcggctggatgggcgta
ccggacggggaagagatgcttcagccaacccgggcgcacggctggatgcatcagatgacc
tgcccgcgcgaattacgctatcgcgacggcaggctctggcagaccccggcgcgcgagctg
gcggcgctgcgtgaagatgagcagcgctggcaggggcgcggtagcgaggcacccgacctg
gacgcgacgcgcctggagtttgagctgagcgcatcgcaggtgaacgtcgattttggcggc
gcactgcgtctcacggtcgatgagcagggtatacgtcttgaacgcgcgagcctgaaaacc
ggtgaaacgctgacccgctactggcagggcaacgtcactcatttacgcgttctgtgcgac
cgctccagcgttgaaatcttcatcaatcacggtgaaggggtgatgagcagccgctatttt
cctgaccatccggcccgggtgcgattcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcgcctgcatgatagaatga

DBGET integrated database retrieval system