KEGG   Enterococcus avium: EH197_00430Help
Entry
EH197_00430       CDS       T05982                                 

Gene name
aph(2'')-Ia
Definition
(GenBank) aminoglycoside O-phosphotransferase APH(2'')-Ia
  KO
K19883  bifunctional aminoglycoside 6'-N-acetyltransferase / aminoglycoside 2''-phosphotransferase [EC:2.3.1.82 2.7.1.190]
Organism
eav  Enterococcus avium
Brite
KEGG Orthology (KO) [BR:eav00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:eav01504]
    EH197_00430 (aph(2'')-Ia)
Enzymes [BR:eav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.82  aminoglycoside 6'-N-acetyltransferase
     EH197_00430 (aph(2'')-Ia)
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     EH197_00430 (aph(2'')-Ia)
Antimicrobial resistance genes [BR:eav01504]
 Gene variants
  Aminoglycoside resistance genes
   N-Acetyltransferases
    EH197_00430 (aph(2'')-Ia)
   O-Phosphotransferases
    EH197_00430 (aph(2'')-Ia)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Acetyltransf_8 Acetyltransf_1 Acetyltransf_3 Acetyltransf_7 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: QCQ10711
UniProt: A0A4P8K7T4
Position
unnamed:complement(77884..79323)
Genome map
AA seq 479 aa AA seqDB search
MNIVENEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEPWEDEVFR
VIIEYNNVPIGYGQIYKMYDELYTDYHYPKTDEIVYGMDQFIGEPNYWSKGIGTRYIKLI
FEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRYD
DNATNVKAMKYLIEHYFDNFKVDSIEIIGSGYDSVAYLVNNEYIFKTKFSTNKKKGYAKE
KAIYNFLNTNLETNVKIPNIEYSYISDELSILGYKEIKGTFLTPEIYSTMSEEEQNLLKR
DIASFLRQMHGLDYTDISECTIDNKQNVLEEYILLRETIYNDLTDIEKDYIESFMERLNA
TTVFEGKKCLCHNDFSCNHLLLDGNNRLTGIIDFGDSGIIDEYCDFIYLLEDSEEEIGTN
FGEDILRMYGNIDIEKAKEYQDIVEEYYPIETIVYGIKNIKQEFIENGRKEIYKRTYKD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagttgaaaatgaaatatgtataagaactttaatagatgatgattttcctttg
atgttaaaatggttaactgatgaaagagtattagaattttatggtggtagagataaaaaa
tatacattagaatcattaaaaaaacattatacagagccttgggaagatgaagtttttaga
gtaattattgaatataacaatgttcctattggatatggacaaatatataaaatgtatgat
gagttatatactgattatcattatccaaaaactgatgagatagtctatggtatggatcaa
tttataggagagccaaattattggagtaaaggaattggtacaagatatattaaattgatt
tttgaatttttgaaaaaagaaagaaatgctaatgcagttattttagaccctcataaaaat
aatccaagagcaataagggcataccaaaaatctggttttagaattattgaagatttgcca
gaacatgaattacacgagggcaaaaaagaagattgttatttaatggaatatagatatgat
gataatgccacaaatgttaaggcaatgaaatatttaattgagcattactttgataatttc
aaagtagatagtattgaaataatcggtagtggttatgatagtgtggcatatttagttaat
aatgaatacatttttaaaacaaaatttagtactaataagaaaaaaggttatgcaaaagaa
aaagcaatatataattttttaaatacaaatttagaaactaatgtaaaaattcctaatatt
gaatattcgtatattagtgatgaattatctatactaggttataaagaaattaaaggaact
tttttaacaccagaaatttattctactatgtcagaagaagaacaaaatttgttaaaacga
gatattgccagttttttaagacaaatgcacggtttagattatacagatattagtgaatgt
actattgataataaacaaaatgtattagaagagtatatattgttgcgtgaaactatttat
aatgatttaactgatatagaaaaagattatatagaaagttttatggaaagactaaatgca
acaacagtttttgagggtaaaaagtgtttatgccataatgattttagttgtaatcatcta
ttgttagatggcaataatagattaactggaataattgattttggagattctggaattata
gatgaatattgtgattttatatacttacttgaagatagtgaagaagaaataggaacaaat
tttggagaagatatattaagaatgtatggaaatatagatattgagaaagcaaaagaatat
caagatatagttgaagaatattatcctattgaaactattgtttatggaattaaaaatatt
aaacaggaatttatcgaaaatggtagaaaagaaatttataaaaggacttataaagattga

DBGET integrated database retrieval system