KEGG   Enterococcus avium: EH197_05065
Entry
EH197_05065       CDS       T05982                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
eav  Enterococcus avium
Pathway
eav00472  D-Arginine and D-ornithine metabolism
eav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    EH197_05065
Enzymes [BR:eav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     EH197_05065
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF1127
Other DBs
NCBI-ProteinID: QCQ11585
UniProt: A0A4P8KAG5
Position
929965..930324
AA seq 119 aa
MENIKFEDARKHLADLSDEELKARFWQLAEEVVEPMLDMGKKYTSPSIERSVLLRMGFSS
IEATEIVKRVLSHELMGKGAGHIVYRIAKENGLSVRDAGLKLADGELWEQVDRIFKEAN
NT seq 360 nt   +upstreamnt  +downstreamnt
ttggaaaatataaaatttgaggatgcgagaaagcatttagctgatttaagcgatgaggaa
ttgaaggcacgtttttggcaactagcagaagaggtcgttgaaccgatgctagacatgggg
aaaaaatacacctcgccgtcaattgaacgttccgtcttattacgaatgggcttctcatca
attgaagcaacagaaattgttaaacgtgtgctgtcgcatgagctgatgggcaaaggagcc
ggacacatcgtttatcgaatcgccaaagaaaatggtctgagcgtccgagatgccggatta
aaactagccgatggcgaactatgggaacaagtagatcgtatcttcaaggaggcaaactaa

DBGET integrated database retrieval system