KEGG   Enterococcus avium: EH197_05070
Entry
EH197_05070       CDS       T05982                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
eav  Enterococcus avium
Pathway
eav00472  D-Arginine and D-ornithine metabolism
eav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    EH197_05070
Enzymes [BR:eav01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     EH197_05070
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: QCQ11586
UniProt: A0A4P8KCV8
Position
930326..932551
AA seq 741 aa
MSKEMKLDENKKLDIHEILDDLANYRPRRRGWSWRTPVPRYKMHSFEYHDMAESLKKYVP
LPSAKYFDNIDPQGTSSITTEIASGRFEDDIRRMRMAAWHGADHLMVIRTAGQSHFEGLI
EGTPQGIGGIPITRKQVRAQRKALDAIEDEVGRPINYHSYVSGIAGPEVAVMFAEEGVNG
AHQDPQYNVLYRNINMIRSFVDACESKKVMAWAGIAQIDGAHNANATAREAWKVMPELMV
QHAINSIFSHKVGMEKSDICLSTVPPTAPPAPSMYLDLPYAVALREFFSDYRMRAQQNTK
YMEASTREATVTHVLNLLISKLTSADIQSTITPDEGRNVPWHIYNIEAVDTAKQVFQGLD
GFGDMVKLLDDGPLRETAREIKERAVLFFEGIIEAGGYFQAVEDAFFVDSGNYPERNEDG
ISRKINGGVGENTVYERDEDYLAPVTAHYGYNNVAQYDEGAVDDPASLIGGSTFEKPEKI
IFIDELDENDNVNVRLEENKELREKELIKPEAEWQGDGIILLTMMLPESKRVAEFAALEI
GKKMGLVDCEVINKEVMQAAEGTRIELKGRVPFTIDKATLVIPEEPKTLSDDEIREEVKR
KKMVIVAGTVGEDEHSVGLREIIDIKHGGIEKYGMEVHYLGTSVPVEKIVDAAIELNADA
ILASTIISHDDIHYRNMKRIHELAIEKGVREKIMIMAGGTQVIPEIAVENGMDAGFGRGS
NGANVATALVELRKEMEREEV
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgtcaaaagagatgaagcttgatgaaaataaaaagttagatatacacgaaattttggat
gatttagccaattatcgtccaagacgtcgcggctggtcgtggcgtacgccagttccacgc
tacaagatgcacagctttgaataccatgacatggcggaatccttaaaaaaatatgttccc
ttaccgtctgcaaaatattttgacaatattgatcctcaaggaacctcttcaattacaacg
gaaatagcttcaggtcgttttgaagatgatattcgcagaatgcggatggccgcatggcat
ggtgccgatcatctgatggtgattcgtacggcaggtcagtcccattttgaagggctgatt
gagggcacaccgcaaggaatcggcggtattccaattacgcgaaaacaagttcgagcgcaa
agaaaagcgttggatgcgattgaagacgaagtaggccgtccaattaattatcatagctac
gtttcaggaatcgctggtccagaggttgcggtaatgttcgccgaagaaggagtcaacggc
gctcaccaagatccgcaatacaatgtattgtatcgcaatattaatatgattcgttcgttt
gtcgatgcctgtgaatcgaaaaaggtgatggcttgggcaggaatagcccaaattgacggg
gcgcataacgcgaatgctacggcacgcgaagcctggaaggttatgcctgagctgatggtc
cagcacgcgattaattcgatcttctcccataaagtcggaatggaaaaatcagacatctgc
ttgtccaccgttccaccaacggcaccaccagcaccatcaatgtacctagacttgccgtat
gctgttgctttgcgggaatttttcagcgactatcggatgcgtgcgcagcagaatacaaaa
tacatggaggcctcaacccgtgaagctacggtgactcatgtactgaatctattgatctca
aaattaaccagtgccgatattcaatcaactattacgccagatgagggtcgcaatgttcct
tggcatatttacaatatcgaagctgttgataccgcgaaacaggttttccaaggtttagat
ggctttggtgatatggtgaagctgcttgatgatggcccgttacgagaaacagctcgtgaa
atcaaagaaagagcggtcctgttctttgaaggaatcattgaagcaggcggctacttccaa
gcagttgaagatgctttcttcgtggattctggaaattatccagagcgaaatgaggacgga
atttctcgcaaaattaatggcggtgttggagaaaatacagtttatgaacgagatgaagat
tatttagcgcccgttaccgctcattacggttataacaacgtcgctcaatacgatgagggc
gcggtagatgatcctgcgagtctaattggcggctctacttttgaaaaaccggagaaaatt
atttttatcgacgaactggatgaaaatgacaacgtcaatgttcgtttagaagaaaacaaa
gagcttcgagaaaaggaattgatcaaaccagaagcagaatggcagggcgatgggattatc
ctactaacaatgatgcttccagaatcaaaacgtgtggcagaatttgcggcgctagaaatt
gggaagaagatgggtctggtcgattgcgaagtgatcaacaaggaagtgatgcaggccgcc
gaaggaacacgaatcgagctaaaaggccgggtaccatttacgattgataaagccacttta
gtcattcctgaagaaccaaaaacattgtcggacgatgaaattcgcgaagaagtaaaacgc
aaaaaaatggtgattgttgcaggaacagtaggcgaagatgaacattctgtaggattgcgt
gaaatcatcgacatcaaacacggcggaattgaaaaatacggaatggaagttcattactta
gggacgagtgtaccagttgaaaaaatagtggatgcggcaatcgaattaaacgccgacgca
atcctagcttcaacgattatcagtcatgatgatattcattaccgtaacatgaaacggatt
cacgaattagcaattgaaaaaggcgttcgtgaaaaaatcatgatcatggctggaggaacc
caagttattccagagatcgctgttgaaaatggaatggacgctggctttggtcgaggaagt
aatggagcaaatgttgcaacagcgttagtagagctcaggaaagaaatggaaagagaagaa
gtctaa

DBGET integrated database retrieval system