KEGG   Enterococcus avium: EH197_15200Help
Entry
EH197_15200       CDS       T05982                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
eav  Enterococcus avium
Pathway
eav00670  One carbon pool by folate
eav01100  Metabolic pathways
eav01120  Microbial metabolism in diverse environments
eav01200  Carbon metabolism
Module
eav_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EH197_15200
Enzymes [BR:eav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     EH197_15200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA Pox_A6
Motif
Other DBs
NCBI-ProteinID: QCQ13462
UniProt: A0A437UP18
Position
2974779..2976452
Genome map
AA seq 557 aa AA seqDB search
MKTDIEISQATTLAPITEVAEKINLSFDDLELHGKYKAKIEFDALERMKENPEGKLILVT
SINPTPAGEGKSTVTIGLGDALNKIGKKTVIALREPSLGPVMGIKGGATGGGYAQVLPME
DINLHFTGDMHAITTANNALSALLDNHIHQGNQLNIDARRVIWKRVVDLNDRELRHITVG
LGGPINGVPREDGFDITVASEIMAILCLATDIEDLKQRLSNIVVAYTFDREPVTVGDLKV
EGALALVLKDAIKPNLVQTIYQTPAFVHGGPFANIAHGCNSILATRAALHCGDYVVTEAG
FGADLGGEKFLDIKVPSLGKAPDAVVIVATIRALKMHGGMAKADLSMENLDALKNGFSNL
AKHIRNMRKYGLPVVVAINEFISDTDKEITLLKELCEQEDVKVELASVWEKGPDGGIDLA
KTVVETIANEENHFHSIFTREHDDLTEKVETIVREIYGGNEVIYSKKAQQQLASFKKYGW
DRLPICMAKTQYSLSDDPSKLGAPIDFDVTIREFVPKIGAGFVVALTGDVMTMPGLPKKP
AALNMDVDEKGNAIGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgatatcgaaatatctcaagcgacgactttagcaccaattacggaggtcgca
gaaaaaatcaacttatcttttgatgatttggaattgcatggcaaatacaaagcaaaaatt
gagtttgatgctttagaacggatgaaagaaaatccagaaggcaaattgattcttgtcaca
tcaatcaatccaacgccggcaggggaaggaaaatcaactgttacgattggattaggcgat
gctttaaataaaataggcaagaagactgtgatcgctcttcgtgagccttctttaggacca
gtgatgggtatcaaaggcggcgcaactggtggaggctatgcacaggtcttacctatggaa
gatattaatctgcactttactggcgatatgcacgcgatcacaacggcaaataatgcgtta
tcagctttactggataatcatatccatcaaggaaatcaattaaacatcgatgcccggcgc
gtgatttggaaacgggttgttgatctgaatgaccgtgagttgcgccatatcactgttggc
ttgggcggtccgatcaatggagttccccgcgaagacggctttgatattactgtcgccagc
gaaattatggcaattttatgtttagcaacagatattgaagacttgaagcagcgcttatca
aatatcgttgttgcctacacctttgatcgtgagcccgtaacagtcggcgatttgaaggtg
gaaggagcactagcgcttgttcttaaagacgcaatcaaacctaatttggttcaaaccatt
tatcaaacacctgcgtttgtgcatggcggaccatttgcgaatatcgctcatggctgtaat
agtattttagcaactcgagctgctctgcactgcggtgattatgtggtcacagaagcgggc
tttggtgcggatcttggcggggaaaaattcttggatattaaagttcctagtttaggaaaa
gctcccgacgctgtagtgatcgttgcaactatcagagcactgaagatgcatggcggaatg
gctaaagctgatttaagtatggaaaatcttgatgcattgaaaaacggcttcagcaattta
gccaagcatattcgtaatatgcgcaaatatggattaccagtagttgttgctatcaacgaa
tttatcagtgacactgacaaggaaattacactattaaaagagctttgcgaacaagaagat
gtgaaggtcgagttggctagcgtctgggagaaaggacctgacggcggcatcgatttagca
aagacagttgttgagacgattgcaaatgaagaaaatcatttccattcaatctttaccaga
gaacatgatgacttaactgaaaaagttgaaacgatcgttcgcgagatttatggcgggaat
gaagttatctatagtaaaaaagcacagcagcaattggccagcttcaagaaatacggctgg
gatcgtttgcctatttgcatggcgaagacacagtattcattatcagacgacccaagtaaa
ttaggggctccaattgattttgatgtgacgatccgcgaatttgtaccgaagattggcgca
ggatttgtcgtagcgctgactggtgacgtcatgacgatgccgggattacctaaaaagcct
gctgctttaaatatggatgttgatgaaaagggcaatgctatcggcttgttctag

DBGET integrated database retrieval system