KEGG   Enterococcus avium: EH197_18485Help
Entry
EH197_18485       CDS       T05982                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
eav  Enterococcus avium
Pathway
eav00480  Glutathione metabolism
eav00590  Arachidonic acid metabolism
eav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    EH197_18485
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EH197_18485
Enzymes [BR:eav01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EH197_18485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: QCQ14036
UniProt: A0A4P8KIK4
Position
complement(3618716..3619189)
Genome map
AA seq 157 aa AA seqDB search
MTVYNFEVKQTDGTEKSLADYQGKVLLIVNTATGCGFTPQYEGLQDLYDHYKDSGFEILD
FPCNQFGNQAPGTNAEVADFCQMNYHTTFETFGKIDVNGENEAPLYSYLKSAQGGLLNKA
IKWNFTKFLIDREGNVIKRYASQTKPEDIAKDIEAQL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttataactttgaagtgaaacaaacggatgggacagaaaaatctttagcggat
tatcaaggaaaagttttattgatcgttaatacagcaaccggatgcgggtttacaccgcaa
tatgaaggattgcaagacttgtatgaccattataaagatagcggctttgaaattctggat
tttccttgcaatcaatttggaaatcaagcacctggcaccaatgccgaagtcgcagatttt
tgtcagatgaattatcatacgacgtttgaaacatttggaaaaatcgatgtgaacggcgaa
aatgaagccccattgtatagctatctaaagagtgcgcaaggtggtttacttaacaaagct
atcaaatggaattttacaaaattcctgattgatcgtgagggaaacgtaataaaacgctat
gcatcacaaacaaagccagaagatattgcaaaagatattgaagcccaactttaa

DBGET integrated database retrieval system