KEGG   Enterococcus avium: EH197_19840Help
Entry
EH197_19840       CDS       T05982                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
eav  Enterococcus avium
Pathway
eav00051  Fructose and mannose metabolism
eav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EH197_19840
Enzymes [BR:eav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     EH197_19840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N UPF0052 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: QCQ14285
UniProt: A0A437ULV0
Position
complement(3897268..3898407)
Genome map
AA seq 379 aa AA seqDB search
MQATHFGAGNIGRGFIGEILAKNGFSIDFVDINETIINALNERNEYTIQLADESQKEIHV
ANVDGLNNQINPEAVIDSVSKADIVTTAIGPNILPFIAELIAKGIQKRRSEGNTAALDVV
ACENMIGGSQFLFEKVQTFLSAEDLAFVDQCIGFPNAAVDRIVPIQHHDDPLFVSVEPFS
EWVIDATQSKNKELRLEGVEYVEDLEPYIERKLFSVNTGHATVAYTGAYAGYQTIDEAIA
DERVLEKLRAVLGETGELLINKWNFDKEKHFAYIDKIVSRFENKYISDSISRVARTPIRK
LGFDERFIRPIRELKERGLEYDNLVDVVAMVLKYDDPNDEQSVELQGLLKEKSAAEVIQQ
VTDLKDDELIAEISATYHK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaacacactttggcgcaggaaatattggacgtggatttattggagaaatttta
gcaaaaaatggtttttcaattgattttgttgatatcaatgaaacaattatcaatgcattg
aatgaacgcaacgaatacacgattcaattagcagatgaaagtcaaaaagaaattcatgtc
gcaaatgtggacggcttgaacaatcaaatcaatccagaggctgtgattgattccgttagt
aaagcagatattgtaacgacagcgattggtcccaatatcttaccctttatcgcagaatta
attgctaaagggattcaaaagcgtcgcagtgaaggcaatacagctgctctagatgtagta
gcctgcgaaaatatgatcggcggtagtcaatttttatttgaaaaggtccaaactttttta
tccgcagaagatctggcttttgtagaccaatgcatcggatttcccaatgcggcagtcgat
cgaattgtgccaatccaacatcacgatgatccattgttcgtatcagtggaacctttcagt
gaatgggtaatcgatgcgacacaaagtaaaaacaaagagctgcgtctagaaggtgtggaa
tatgtagaggatttggaaccttatattgaacggaagttattctccgtcaatactggacat
gcgacggttgcttatactggagcatatgcagggtatcaaacaatcgatgaagcgattgcc
gatgaacgtgtactagagaaattacgtgcagttcttggcgaaacgggagagttattgatt
aataaatggaattttgataaagagaagcattttgcttacattgataagatcgttagtcgt
ttcgaaaataaatacatttcggatagtatcagtcgtgtggcgcggacaccgattcgtaag
ttgggctttgatgaacgattcattcgtccgattcgggaattaaaagagcgcggtcttgaa
tacgataatttagtagatgtcgtagcaatggttttgaaatacgatgatccgaacgatgaa
caaagtgttgaattgcaagggttgctaaaagagaaatcagcagccgaagtgatccagcag
gttactgatttaaaagatgatgagttaatcgctgaaatttcagcaacatatcacaaatag

DBGET integrated database retrieval system