KEGG   Erwinia amylovora ATCC 49946: EAM_0369Help
Entry
EAM_0369          CDS       T01199                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_0369
Secretion system [BR:eay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAM_0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: CBJ45044
Position
448131..449480
Genome map
AA seq 449 aa AA seqDB search
MKIYRPLWNEGALLSPQQFQQQSEWESFRSAGISALASPFPWGVETLKFDDPLLASGLIQ
ISPLRLWLEDGSLIDAQCSDLPPVPRELNSAQLAGLDAVTVVIALPLMQQGVNNVQQDAE
MSDRPQRYREEWLPVQDAFGTEEEFMAVARFNYSIRFAHENNASWRTCPVARLIWDGQNG
WRQDAAFIPPVALFSASPMLCERLVLLNRQLRSRRQRLMAMRRESNERLADFAVADVSLF
WLLNALNSHARVLSEYERFPARHPEQVWAELARLAGSLLTFSLNHDLDAIPGYDHAEPAH
TFPPLFELITGLLEASLPSRVIALEMSRPDEQTWKASLHDIRLREEADLYLSVRSDIPAW
QLADKFPALCQAGSPDDVKEIYSAALKGIPLIAVSRVPAALPVRMENQYFALDMESPAAR
EMQDQGVCMFYVPALLGRLELELFAVLRS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttatcgtccattgtggaatgagggggcgctgctgtccccccagcaattccag
cagcagtcggaatgggagtcttttcgcagtgcggggatctctgcactggcctcgccattt
ccgtggggagtggaaacgctaaagtttgatgaccccctgctggcttccgggctgatccag
atctcaccgctgcgtctctggctggaagatggctcccttatcgatgcgcaatgcagcgat
ctgccgcctgtaccacgagaactcaattccgctcagttggcgggtcttgatgcggtcact
gtcgttattgcgctgcccctgatgcagcaaggtgtgaacaacgttcagcaagatgcggag
atgtcagacagaccgcagcgctatcgcgaagagtggctaccggttcaggatgctttcggc
acggaagaagagttcatggccgtcgcccgcttcaattactccatccggtttgcccatgaa
aataacgcgtcgtggcgaacctgccctgtggcgcgtctgatttgggacggacagaacgga
tggcgtcaggacgcggcgtttattcctcctgtggccttattctccgccagcccgatgctg
tgcgaacgcctggttctgctcaatcgccagcttcgctcccgccgtcagcgcctgatggct
atgcgtcgtgagagtaatgaacgtctggctgatttcgccgttgccgatgtttcgctgttc
tggttgctgaacgcgcttaattcccatgcgcgggtgctgtcggaatacgaacgctttccg
gccaggcacccggagcaggtgtgggcagagcttgccaggctggcgggcagcctgctgacc
ttttctctcaaccacgatctggacgctattcccggctatgaccacgctgaaccggcccat
actttcccgccgctgtttgaactgataaccggtttgctggaagccagcctgccgtcgagg
gtgatcgcacttgagatgtcgcgtccggatgagcagacgtggaaagcctctttacacgat
atccgtttgcgcgaagaggccgacctgtacctctccgtgcgctcagatattccagcctgg
cagctcgccgataagtttcctgcactttgtcaggccggttcacccgatgacgtgaaagaa
atctacagcgccgcactcaaggggatcccacttattgccgtcagccgcgtaccggcagca
ttgccggtacgcatggaaaaccagtacttcgcgctggatatggaaagccccgctgcccgc
gagatgcaggatcagggcgtgtgcatgttctatgtgcctgctttgctgggccggctggag
cttgagctgtttgcggtgctgcgatcatga

DBGET integrated database retrieval system